PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl002084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SRS
Protein Properties Length: 519aa    MW: 57064.8 Da    PI: 6.5128
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-18454PU_refplantGDBView CDS
gnl|UG|Pgl#S55335364PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70226.12.4e-08136170539
     DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathv 39 
                + +C +CGn a+  C ++ C+ CC      C+ hv
  Pgl002084 136 KPKCSECGNVARSRCPFQACKSCCVKARNPCHIHV 170
                568*********************99999*****9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.1E-6138183IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MEGVTTSDTK DASTPCPSPS TTSAPASAVP ATLPKPQLSK QMEGIIISDT KDTSTPCLSP  60
STASAPASAV AATLPKPQRP PPSNLPSEGM VSPQTNTPLI GANATTPSPS TTNNTARNNH  120
NSASAEAPKS LRGLNKPKCS ECGNVARSRC PFQACKSCCV KARNPCHIHV LKQNASYPEK  180
VPSQSSPLFD QQRTNALSNK FPPSGSSRPY STPVLHHTHP YMSGSLSQSR VKRPLSRKEI  240
AAINNWRFVK LKEYCDSKIE AEDEAFGRYM QNVSLLEDVF SLPTRPLEGL SEDGNVTFES  300
RLSEQANSVS EDYNDDMLVE GLKVRLKSNT ERSEEHRQRL RKLIEKGLQK LKRGDHGNLV  360
EDDENNSALI LGDCAEVKKL KAIGRERLKK VSLISTLLDK LSKARNQEDV NACIEMYSHT  420
FGMDISGSAI NTNISEEIHS SQGQECMPDS NPSENESTPM EWVGEDRSSE RNGLFDGQQM  480
QFFSNPEIYI KGWTEINISE ERSQYIYENL LSMKDIAEL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.214440.0stem| vegetative bud
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.11e-63