PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl001752
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 577aa    MW: 62695.8 Da    PI: 10.1153
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-19362PU_refplantGDBView CDS
gnl|UG|Pgl#S55332333PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.51e-061432062
               HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1 20 sRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
               sRqRKk +++eLeekvk++ +   +L +++  ++ e  klk++
  Pgl001752  1 SRQRKKSYVDELEEKVKSMNSTIAELNNTIAFINAENMKLKQQ 43
               8***************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.7E-10145No hitNo description
CDDcd147043.20E-8138No hitNo description
SuperFamilySSF579592.81E-5244No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
SRQRKKSYVD ELEEKVKSMN STIAELNNTI AFINAENMKL KQQLGALCQP PNTANQHHVT  60
PLPMPYPWPP FPAYPGPVMA GGNGGRVPLL PIPRLKSHSQ QQPSTPYKDR KPSKSAAAAV  120
SSEQKPAKKR IKKVASIAFL GFFFFIFFIL GGIGQLPIAK DLIFRESSSR ELLGNSIVEL  180
SRAGLLLKPG GGGRVLTSWD EGGNFTEVAV RNNPLGDVHV DMDIGTGRLP GSEKRHDKRN  240
ATFTDHYTHS DSDLMNMNSY IYPEKNGSAA LVASLFVPRN DKLVKIDGNL IIHAVLAGEK  300
ASRASSASQS RGNKEGHVDT ISLKKESEKN SLAVRAERHR AFAAAAAATT DSGRNVDTNT  360
KFLGDAAENP NYRALASNFR TSYRDDMEST AVDRSLQQWF QEGLAGPVLS SGMCTEVFQF  420
DASPNSPSTT ANSKLVTSVA SRIANNSGGR PSNNSSGSKI NEARRSAPVY MSKNRRVSYA  480
VPLPPAGPPL KDRNERNFTD HAEIIHEERG YRGNNTAPSS MVVSILVDPR ETNDDGMLSS  540
GSLSRIFVVV LVDSVKYVTY SCVLPAKGSG PHLVTRF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5A8D10.0D5A8D1_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-47bZIP family protein