PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl001516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 668aa    MW: 73270 Da    PI: 5.5659
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-45011PU_refplantGDBView CDS
gnl|UG|Pgl#S55332830PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.81.3e-162451356
               HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox 13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +e+e +F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Pgl001516  2 QEMEMFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 45
               79***************************************999 PP

2START223.56.5e-701844061206
                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                ela +a++elv++a+++ep+W++ +    +++n+de++++f+++ +      + ea+r+++vv+m++ +lve+l+d++ qW+ +++    +  t++v s+
  Pgl001516 184 ELAVAAMEELVRMAQLGEPLWTSHPedstDILNEDEYIRTFPRGIGprpygLKAEASRETAVVIMNAINLVETLMDVN-QWSSMFPgivsRPFTVDVFST 282
                57899**************************************999********************************.*********99999******* PP

                T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHH CS
      START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwl 180
                g      galq+m ae+q++splvp R+ +fvRy++q+++  w++vdvS+ds + ++  ssv+R++++pSg+li++++n +skvtwvehv+ ++r +h +
  Pgl001516 283 GvagnynGALQVMHAEFQVPSPLVPtREIYFVRYCKQHSDSIWAVVDVSLDSLRGNS--SSVIRCRRRPSGCLIQEMPNSYSKVTWVEHVEADDRAVHHI 380
                *******************************************************95..8**************************************** PP

                HHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 181 lrslvksglaegaktwvatlqrqcek 206
                +r+lv+sg+a+gak+w atlqrqce+
  Pgl001516 381 YRQLVNSGMAFGAKRWIATLQRQCER 406
                ************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.337147IPR001356Homeobox domain
CDDcd000863.72E-15248No hitNo description
PfamPF000463.5E-14245IPR001356Homeobox domain
SuperFamilySSF466891.13E-13251IPR009057Homeodomain-like
SMARTSM003895.1E-8251IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-15254IPR009057Homeodomain-like
PROSITE patternPS0002702245IPR017970Homeobox, conserved site
PROSITE profilePS5084847.882175409IPR002913START domain
SuperFamilySSF559613.13E-41176408No hitNo description
CDDcd088751.09E-136179405No hitNo description
SMARTSM002342.6E-67184406IPR002913START domain
PfamPF018524.2E-58185406IPR002913START domain
Gene3DG3DSA:3.30.530.203.8E-7283406IPR023393START-like domain
SuperFamilySSF559614.82E-25426660No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
XQEMEMFFKE CPHPDDKQRK ELSRELGLEP LQVKFWFQNK RTQMKTQHER HENTQLRSEN  60
EKLRSENMRY REALNNASCP NCGGPASLGE MSFDEQQLRM ENARLREEID RISGIAAKYV  120
GKPLLSFGPS PLSSIPRSNL DLAVGSYGLQ PNIGPDIYGS SSGGEIGNRS LVGPTEGEKP  180
MVVELAVAAM EELVRMAQLG EPLWTSHPED STDILNEDEY IRTFPRGIGP RPYGLKAEAS  240
RETAVVIMNA INLVETLMDV NQWSSMFPGI VSRPFTVDVF STGVAGNYNG ALQVMHAEFQ  300
VPSPLVPTRE IYFVRYCKQH SDSIWAVVDV SLDSLRGNSS SVIRCRRRPS GCLIQEMPNS  360
YSKVTWVEHV EADDRAVHHI YRQLVNSGMA FGAKRWIATL QRQCERLASV LASNIPARDL  420
GVIPSPEGRK SILKLAERMV TSFCAGVSAS TAHTWTTLSG SGAEDVRVMT RKSIDDPGRP  480
PGIILSAATS LWLPVPPKKV FDFLRDENSR NEWDILSNGG LVQEVDHIAN GQDPGNCVSL  540
LRVNTVNSNQ SNMLILQESC TDASGSFVIY APVDIVAMNV VLSGGDPDYV ALLPSGFAIL  600
PDSPKCMAVT NSGINDLGTG GSLLTVAFQI LVDSVPTAKL SLGSVATVNS LISCTVDRIK  660
AAVMRENP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826512.20.0homeobox-leucine zipper protein ROC2 isoform X2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLQ9FR590.0Q9FR59_PICAB; Homeobox 1
STRINGERM937490.0(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]