PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl001423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 752aa    MW: 82979 Da    PI: 5.8647
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-36793PU_refplantGDBView CDS
gnl|UG|Pgl#S55341759PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.91.9e-37312371261
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                ++k l+cprCds  tkfCyynny+++qPr+fCk C+ryWt GG++rnvPvG+grrknk+ 
  Pgl001423 312 TDKLLRCPRCDSPGTKFCYYNNYNVNQPRHFCKDCQRYWTVGGTMRNVPVGAGRRKNKHL 371
                67889****************************************************985 PP

2Myb_DNA-binding31.73.6e-10436477346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT eE + l++a+ ++  + Wk +a+++g ++++ +c+sr+ +
        Pgl001423 436 EWTDEETLVLLEAIFLHNDD-WKCVAQHVG-TKSEADCVSRFIQ 477
                      7****************988.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.96E-3063157IPR009057Homeodomain-like
PROSITE profilePS5093427.69864161IPR007526SWIRM domain
Gene3DG3DSA:1.10.10.102.3E-3165162IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF044333.8E-2867152IPR007526SWIRM domain
PfamPF027012.0E-30314370IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.931316370IPR003851Zinc finger, Dof-type
PROSITE patternPS013610318354IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-24318369IPR003851Zinc finger, Dof-type
PROSITE profilePS5129317.176432483IPR017884SANT domain
Gene3DG3DSA:1.10.10.606.9E-6433475IPR009057Homeodomain-like
SuperFamilySSF466892.24E-11433490IPR009057Homeodomain-like
SMARTSM007175.1E-8433481IPR001005SANT/Myb domain
CDDcd001673.27E-7436478No hitNo description
PfamPF002491.6E-9436478IPR001005SANT/Myb domain
PfamPF164958.3E-21661738IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MASPSNTNTS GNTNKDPNPE TTSNQAGSPH DSSNAGIADT ANPPTVLQPD FKEGSSPPRH  60
REIYKIPKYS SWFAWDKIHG TERRFLPEFF DEKSAAKTPK VYKEYRDFII NRYRKNPHKR  120
ISFTEVRKML VGDVNSIRRV FDFLDNWGLI NYQVASSKQH TKAEGNAGGV GEKGAATRVL  180
GQKGLAASEG DPPPGGTATN STVIDGKDKK GTEWQSGLLC NNCGADCSIA RFDCLKEVIS  240
PKSRDEDLSK EPGNSSGTND CNVEGVKTSK QDPEKELPVT AMEEESKDEK GDETNKEEVE  300
QNGNKDKLLR KTDKLLRCPR CDSPGTKFCY YNNYNVNQPR HFCKDCQRYW TVGGTMRNVP  360
VGAGRRKNKH LGTHYWHTMK SVGLTPARTG ASDAAHYSGF VLCPKCYENG NYGLGLSASD  420
FKRIELKEVS QQKSVEWTDE ETLVLLEAIF LHNDDWKCVA QHVGTKSEAD CVSRFIQLPF  480
GEQYIGNISN EVSDRRSSNV TGENTVIKQV SSPKDRSTQD LQDHVSNDDK HTMDDVLGPP  540
LKRRHLTPLA DASNPIMGQV AFLSAMVGSH VAEAAAHAAI AALSEEDPSA SQVTSTEEAE  600
CPNQKNGTGA SGLEGSPKDF AIEDSKKESH GGTDQTTEDG DSLAGEKEMT TPTVEMRAAT  660
ATALGSAAVR AKLLADQEDQ DIENLFSTVV DTQMKKLQER IQHFEEFDIV TEKERSQVEN  720
IKELLFADRI RFIQNTIKSR FSGSKEKELE AA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2fq3_A2e-236915616103Transcription regulatory protein SWI3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NWA40.0A9NWA4_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-31cycling DOF factor 3