PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl001215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 177aa    MW: 20204 Da    PI: 7.0731
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S25726235PU_refUnigeneView CDS
PUT-175a-Picea_glauca-25091PU_unrefplantGDBView CDS
gnl|UG|Pgl#S40975352PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.42.9e-49161421128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lp GfrF+Ptdeel+ +yLkkkv+++++++ ++i+e+d y+++PwdLp+k+  +ekewyfFs+rd+ky ++ r+nr++ sgyWkatg+dk+++ +++++v
  Pgl001215  16 LPTGFRFDPTDEELLIHYLKKKVSSSPFPA-SIIAEIDPYSHDPWDLPAKAFFGEKEWYFFSPRDRKYLNEARPNRSAGSGYWKATGTDKSIVITSSQKV 114
                799***************************.89***************8777899********************************************* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk+Lvfy+g   +g kt+W+mhey l
  Pgl001215 115 GVKKSLVFYTGMPLEGLKTNWIMHEYGL 142
                **************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5411146IPR003441NAC domain
PROSITE profilePS5100550.11416160IPR003441NAC domain
PfamPF023654.7E-2717141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MTIDGLPFHQ QLLPQLPTGF RFDPTDEELL IHYLKKKVSS SPFPASIIAE IDPYSHDPWD  60
LPAKAFFGEK EWYFFSPRDR KYLNEARPNR SAGSGYWKAT GTDKSIVITS SQKVGVKKSL  120
VFYTGMPLEG LKTNWIMHEY GLAETLPSER KGSMLDIRES ESFFHGCFVL GFRDTVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-591615317151NO APICAL MERISTEM PROTEIN
1ut4_B4e-591615317151NO APICAL MERISTEM PROTEIN
1ut7_A4e-591615317151NO APICAL MERISTEM PROTEIN
1ut7_B4e-591615317151NO APICAL MERISTEM PROTEIN
3swm_A5e-591615320154NAC domain-containing protein 19
3swm_B5e-591615320154NAC domain-containing protein 19
3swm_C5e-591615320154NAC domain-containing protein 19
3swm_D5e-591615320154NAC domain-containing protein 19
3swp_A5e-591615320154NAC domain-containing protein 19
3swp_B5e-591615320154NAC domain-containing protein 19
3swp_C5e-591615320154NAC domain-containing protein 19
3swp_D5e-591615320154NAC domain-containing protein 19
4dul_A4e-591615317151NAC domain-containing protein 19
4dul_B4e-591615317151NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098344.16e-67NAC transcription factor 56
SwissprotQ84TD61e-64NAC47_ARATH; NAC transcription factor 47
TrEMBLD5ABS03e-92D5ABS0_PICSI; Uncharacterized protein
STRINGXP_007149615.14e-65(Phaseolus vulgaris)
STRINGA0A087H6U03e-65(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.27e-66NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]