PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000809
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 327aa    MW: 37209.4 Da    PI: 4.4673
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-15231PU_refplantGDBView CDS
gnl|UG|Pgl#S55349041PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-15232PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.8e-2071124356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++++q++ Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Pgl000809  71 KKRRLSADQVHFLEKSFEVDNKLEPERKTQLARDLGLQPRQVAVWFQNRRARWK 124
                55689************************************************9 PP

2HD-ZIP_I/II133.85.9e-4371160291
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  kkrrls++qv++LE+sFe ++kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE++y+ Lk++yd+l+ + ++L ke+e+Lr+e+
    Pgl000809  71 KKRRLSADQVHFLEKSFEVDNKLEPERKTQLARDLGLQPRQVAVWFQNRRARWKTKQLEREYDILKSSYDTLRVDYDNLLKEKEKLRSEV 160
                  9**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.0E-1962128IPR009057Homeodomain-like
PROSITE profilePS5007117.31366126IPR001356Homeobox domain
SMARTSM003899.8E-2068130IPR001356Homeobox domain
CDDcd000862.00E-1869127No hitNo description
PfamPF000464.2E-1771124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-2173133IPR009057Homeodomain-like
PRINTSPR000319.9E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000319.9E-6106122IPR000047Helix-turn-helix motif
PfamPF021837.3E-17126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MASNGVRFNA SNRNLIVMVN ETPSFEADST PLTSLDGVMK SVSKRPFYNT LDAEEAGDED  60
LLDECVHQPG KKRRLSADQV HFLEKSFEVD NKLEPERKTQ LARDLGLQPR QVAVWFQNRR  120
ARWKTKQLER EYDILKSSYD TLRVDYDNLL KEKEKLRSEV ICLTDKLHAK EKGLEIQTND  180
LETTCKKAFI QSNSQFESLE KSGIVSKGMT APFDQQLVSY SIEDPLSSGT DGSAVVDEES  240
PHHIDSGHSS VVGYVTSTHI SPFEADLSDF SHVDEEEEEE GISEKLLLPQ DCHMKMECIL  300
FPEAPTTSCT YVFAMDDQEN LSWWDWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.50460.0cone| needle| root| stem| vegetative bud
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LKP40.0B8LKP4_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-53homeobox 1