PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 364aa    MW: 40353.3 Da    PI: 9.7202
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-6504PU_refplantGDBView CDS
gnl|UG|Pgl#S55349889PU_unrefUnigeneView CDS
gnl|UG|Pgl#S59016309PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.5e-16294337548
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                +r++r++kNRe+A rsR+RK+a++ eLe++v +L++eN++Lkk+
  Pgl000721 294 RRQKRMIKNRESAARSRARKQAYTNELENEVMQLKEENERLKKQ 337
                79***************************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-15284337No hitNo description
SMARTSM003386.9E-15290353IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484292337IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-11294337No hitNo description
PfamPF001708.4E-13294337IPR004827Basic-leucine zipper domain
CDDcd147073.83E-27294348No hitNo description
PROSITE patternPS000360297312IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGSRTMLSSN GGRTPQFQPL VRQNSLYNLT LEEVQNQLGD ASKPLSSMNM DELLKNIWTA  60
EESQAITMAI GNGPMNGVPP NSVPASSGLQ RQGSLTIPRT LSRKTVDEVW RDIQQSQGKG  120
NEEKKPQQRQ STFGEMTLED FLVKAGVVRE DNNGNSNNNN NSIVTVGIPE TPQPVSVCGV  180
PTAGIGMDAM AAAQNLQQQA EWYQYQLNTA QQQQQQQQQQ QQQQQSMMVA YGTKRAVPQN  240
GPLVIPGHPL MEGGYGDNQL ALSSPLMGCT SSDSQTPGRK RGAPESIIEK TVERRQKRMI  300
KNRESAARSR ARKQAYTNEL ENEVMQLKEE NERLKKQQFL EKLLPTVPPP QPKHTLRRSS  360
SAPF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.58900.0cone| needle| root| somatic embryo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006836156.21e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
TrEMBLA0A0D6QWG11e-178A0A0D6QWG1_ARACU; Uncharacterized protein
STRINGPOPTR_0008s01130.11e-106(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.21e-44abscisic acid responsive element-binding factor 1