PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 388aa    MW: 43721.7 Da    PI: 4.5203
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-11993PU_refplantGDBView CDS
gnl|UG|Pgl#S55349208PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-19144197356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t++q++ Le+ Fe ++++  e++ +LAk lgL+ rqV vWFqNrRa++k
  Pgl000665 144 KKRRLTADQVQFLERSFEIENKLEPERKIQLAKDLGLQPRQVAVWFQNRRARWK 197
                56789************************************************9 PP

2HD-ZIP_I/II131.23.9e-42143234192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+++qv++LE+sFe e+kLeperK +la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++y++l+ + ++L ke+++Lr+e++
    Pgl000665 143 EKKRRLTADQVQFLERSFEIENKLEPERKIQLAKDLGLQPRQVAVWFQNRRARWKTKQLERDYDILKSRYENLRVDYDSLLKEKDKLRAEVT 234
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-20132201IPR009057Homeodomain-like
PROSITE profilePS5007117.297139199IPR001356Homeobox domain
SMARTSM003892.5E-19142203IPR001356Homeobox domain
PfamPF000466.9E-17144197IPR001356Homeobox domain
CDDcd000866.13E-19144200No hitNo description
Gene3DG3DSA:1.10.10.601.5E-20145206IPR009057Homeodomain-like
PRINTSPR000312.1E-5170179IPR000047Helix-turn-helix motif
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PRINTSPR000312.1E-5179195IPR000047Helix-turn-helix motif
PfamPF021831.1E-16199240IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGIVVPAVWD LACELSGEAA SFATKFPYRS ATTGSANVSE VGICLAFNVT GGHRLKEYCF  60
EEMMMSGGRM YGGPNVLVMG NENISRSADA LEALLSSPVF NGSRSVANLE EVIGNVSKRP  120
FYNSFDQEET GDEDLDDCIH PPEKKRRLTA DQVQFLERSF EIENKLEPER KIQLAKDLGL  180
QPRQVAVWFQ NRRARWKTKQ LERDYDILKS RYENLRVDYD SLLKEKDKLR AEVTFLTGKL  240
HSKDCDLEAQ TKDSEYVDKK VFPQPASQCV EKFERGTSIK DTPPSCKHED LLSSGTDSSG  300
VLDEDSPHHV DCGHSSLDHV NSHLFEADQS DLSHADEEEE EEGMSEKLLP QTYTYHLLKV  360
EDGPYPDASI ASYNEMFAME DQVPLGPW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.52440.0needle| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242341.11e-90PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022834e-53HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLD5AB830.0D5AB83_PICSI; Uncharacterized protein
STRINGXP_010242341.15e-90(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-55homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]