PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 446aa    MW: 49023.6 Da    PI: 6.3844
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-43772PU_refplantGDBView CDS
gnl|UG|Pgl#S55349709PU_unrefUnigeneView CDS
gnl|UG|Pgl#S40860452PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.1e-10265323563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+  +  l++e+
  Pgl000557 265 KRAKRILANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTLLQRDSMGLTNEN 323
                9********************************************99998887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-18261325IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932263326IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-10265317No hitNo description
PfamPF001701.1E-8265321IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.98E-11265316No hitNo description
CDDcd147037.77E-26266315No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDEHPIPSPR PPVSPFSADS HSRPDASRTG DVLPPRKGGH RRAHSEIPRQ VSWDKVGKGV  60
KKEAEWDRDG DLNMEVGDGE DLFSMYIDLE KLNTLNTTSS ANPADIGEGS GESGRKTLNA  120
DDDNEDDKAG PDDSGGNSVK EKDIDSGDDD AESESNEKKD GHKRSFPGGV DSTGRSHAAA  180
SHHHPHHVRS VSMDSVLSSF QNSENPNQKP APSPTGRNIK HFHSNSMDGS INFKLKFGNG  240
EFSGPELNKI MSNEKLAEIA MTDPKRAKRI LANRQSAARS KERKMRYISE LERKVQTLQT  300
EATTLSAQLT LLQRDSMGLT NENNELKLRL QAMDQQAQLR DALNEALSEE VQRLKLATGQ  360
SISINSHLFQ LQQQGPHVAV HQLQQQQQHQ QQHQQQVTNS QQSPGHQTNQ NEVLQNTYGA  420
FPGSLGSFLK SDGSNIPASQ GSNCSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.86970.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852991.11e-105PREDICTED: probable transcription factor PosF21 isoform X1
RefseqXP_011626470.11e-105PREDICTED: probable transcription factor PosF21 isoform X2
TrEMBLB8LQ180.0B8LQ18_PICSI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t013e-90(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-66bZIP family protein