PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 453aa    MW: 50931.1 Da    PI: 6.9041
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-3541PU_refplantGDBView CDS
gnl|UG|Pgl#S55349708PU_unrefUnigeneView CDS
gnl|UG|Pgl#S29736245PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.3e-56171451129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrFhPtdeel+++yL +kv +++++  ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++++ +++l
  Pgl000542  17 LPPGFRFHPTDEELITHYLVRKVVDSTFTG-RAIAEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIFNArSSSL 115
                79*************************999.89***************99999****************************************9867778 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg+kktLvfykgrapkgek++Wvmheyrle
  Pgl000542 116 VGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 145
                ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6413169IPR003441NAC domain
PROSITE profilePS5100561.88917169IPR003441NAC domain
PfamPF023653.2E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MEGLNFTYAQ DKGDTQLPPG FRFHPTDEEL ITHYLVRKVV DSTFTGRAIA EVDLNKCEPW  60
DLPEKAKMGE KEWYFFSLRD RKYPTGLRTN RATEAGYWKA TGKDREIFNA RSSSLVGMKK  120
TLVFYKGRAP KGEKSNWVMH EYRLEGKFSY NQLPKTSKDE WVVCRIFQKS IGAKKSSSDS  180
TEAHIFDVGS PSLPPLSAVN DESGSLESEG SAREHVSCFS NPQYNNNNNN SGFRTPSHHP  240
QQQRTSADSA ELSEIASIMR STAPFIHNMA LNDPRLSMNS ISRPSPFPPF LNLRQENNHV  300
QQPPLLFSQL AAFPPNSIPT NVSFPMENQA QLHSLLPGLP QNALLRALFD QYNDPGTLKH  360
CKLEPSFGPQ LDKSGKVEQA SQWVETQPRP EINMENNGLP QQMQPQPALS LPQADTCLGI  420
EMNSEMVCNR LNRSFQVGPS STSPVDLDGF WGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-551717520174NAC domain-containing protein 19
3swm_B3e-551717520174NAC domain-containing protein 19
3swm_C3e-551717520174NAC domain-containing protein 19
3swm_D3e-551717520174NAC domain-containing protein 19
3swp_A3e-551717520174NAC domain-containing protein 19
3swp_B3e-551717520174NAC domain-containing protein 19
3swp_C3e-551717520174NAC domain-containing protein 19
3swp_D3e-551717520174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.100500.0root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292765.11e-109uncharacterized protein LOC18434770
RefseqXP_020523105.11e-109uncharacterized protein LOC18434770 isoform X1
RefseqXP_020523106.11e-109uncharacterized protein LOC18434770 isoform X1
TrEMBLG8CPZ00.0G8CPZ0_PICAB; Cup-shaped cotyledon
STRINGERN065711e-108(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.14e-97NAC family protein