PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 710aa    MW: 79518.1 Da    PI: 4.5962
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-15374PU_refplantGDBView CDS
gnl|UG|Pgl#S55341997PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85e-54131402129
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                ppGfrF+P+dee+v +yLk+kv+g+k+e+ +vi+evd+yk+ePwdLp k  + +++ ewyfF++rd+ky++g+r+nrat++gyWkatgkd++v s ++++
  Pgl000339  13 PPGFRFRPSDEEIVGYYLKNKVQGNKFEF-DVIREVDLYKCEPWDLPeKsFLPSRDLEWYFFCPRDRKYPNGSRSNRATEAGYWKATGKDRKVSS-RSNK 110
                9**************************99.9***************95334455777*************************************9.9999 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                +g+kktLvf+kgrap+ge+tdW+mheyrle
  Pgl000339 111 IGTKKTLVFHKGRAPHGERTDWLMHEYRLE 140
                ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-623162IPR003441NAC domain
PROSITE profilePS5100557.80212162IPR003441NAC domain
PfamPF023654.5E-2813139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MASSVQAAAV NFPPGFRFRP SDEEIVGYYL KNKVQGNKFE FDVIREVDLY KCEPWDLPEK  60
SFLPSRDLEW YFFCPRDRKY PNGSRSNRAT EAGYWKATGK DRKVSSRSNK IGTKKTLVFH  120
KGRAPHGERT DWLMHEYRLE GTQCKGGANL QDLYVLSRVF RKAKQGLNDQ EPTQEVGLPM  180
LNNTLSPTDV SDGDIEDQSE DRCSQGKQEE DAPASSSVRS ETSEILDNKA EDNNCIDGPM  240
ETLQDISNPS CNLVSIHETS FNKNDESQRG SQKLQQPASF CLPWEEEDFQ QIPENAYLSN  300
NDYLPGNQIN SSGMESIPFN GNFPVAQDFD EDNLDLSYLL ENFENCPELD EFLPPVEEEN  360
NDEVEIQIRS RPQLWLQQPL PSQGSAPRRL RLQIYKTEAS ANGRKQHLFT LNDQSASYDC  420
NSDDSEVITQ LEDSLQASYP SQISCCGVED DADSDIFHYS VESSERVANG HDFNLAPTQL  480
LIPSFFPIGE ASEKGDMSVN VKESEDKSVL IERSESAMSS ACSQSSSSEV QTETTVSHTT  540
SSQETDMVGV KSSILGMESP TVLASKKVLI SEVASSFGSR QLGAISSNHN AVSESHMSYK  600
GRVKFTGFNV ILSCLKRRGK SREKYVTSDW VEESRNVTEN FPDLCSKDSW KGFSNLKKAL  660
GIFIQPYQLQ SKISKGANCI SLICLLSTVF LVLCIWNTCH FARSSSSIIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-53813911140Stress-induced transcription factor NAC1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1614620LKRRGKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.39270.0needle| somatic embryo| stem| vegetative bud
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.15e-76NAC domain containing protein 57