PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl000101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 652aa    MW: 71717.9 Da    PI: 6.8685
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-31366PU_refplantGDBView CDS
gnl|UG|Pgl#S55347323PU_unrefUnigeneView CDS
gnl|UG|Pgl#S55330511PU_unrefUnigeneView CDS
PUT-175a-Picea_glauca-31367PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42.1e-10455513563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                kr +r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+  +a   s++
  Pgl000101 455 KRVKRILANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTLLQRDSAGIGSQN 513
                8999******************************************9999888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.1E-18451515IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576453516IPR004827Basic-leucine zipper domain
PfamPF001704.5E-9455508IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-11455505No hitNo description
Gene3DG3DSA:1.20.5.1704.4E-11455506No hitNo description
CDDcd147031.00E-24456507No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MEEMDNSYGD LMQRLQSSLG TSSSFIPKQQ LNKSEPSSPA ISQTRPPFTA NIPNFNPGGK  60
RQGIPPSHPH FPPTSPHSQT FFTQMPVLQS PVQQNSQNQQ HSNASPNSLH SRSMSQPHIF  120
NLDNLPPLNP CSYRDPSSPS LSDPVSGDVS MEDQEGSSAV PSISPHNPSS LFAGGRRSPN  180
HMSDGLPPRK GHRRARSDNP FTFMSGSQSL SGDIQQGFGS SLETTSVKGT AQMDHLNQYV  240
SSLEREKPKA RVVKAELNQE RNIIQNVEGM GEGETGREIG EDMVSACIDV DKMNNLNKPR  300
PASGELPDNL NGVQEDSGGS SVKQKNLKDA DQFSSSDEAD SEVNEFDIMK RSNSGVGYEE  360
NKRSAGQGDG SQYLNRSRHS RSVSMDSIMS KMHNFSEDLE QEPSQGRNVR HSHSNSMDGS  420
TSFNVEFGNG EFSASEMKKI MASEKLAELA SVDPKRVKRI LANRQSAARS KERKMRYISE  480
LERKVQTLQT EATTLSAQLT LLQRDSAGIG SQNHELKLRL QTMEQQAQLR DALNEALGEE  540
VQRLKLATGQ LGAGQSASLA QQMSMNSPLF QLQQQGPHHP HHPLYQLQQQ QQQQQQQQQQ  600
HQVKYSQQPP GKQTNRNEVL QTTYTSLPGP VGSSGKPDNS NMSASQGSDC SF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.16710.0stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263926.11e-139PREDICTED: probable serine/threonine-protein kinase mps1
TrEMBLF6I1811e-132F6I181_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.39e-75bZIP family protein