PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG034010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 529aa    MW: 57591.9 Da    PI: 7.6245
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG034010.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24172214244
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                   epgrCrRtDGKkWRCsr+v ++kk+CErH+hrgr rsrk++e
  CCG034010.1 172 LEPGRCRRTDGKKWRCSRDVAPDKKYCERHMHRGRPRSRKHVE 214
                  69***************************************97 PP

2QLQ514.5e-18122154234
          QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                  +FT+aQ+++L++Q+++yKy+a++  vPp+Ll +
  CCG034010.1 122 PFTNAQWNELERQAMIYKYMASSINVPPHLLIP 154
                  8*****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-10121157IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.719122157IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-12122154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.55171215IPR014977WRC domain
PfamPF088795.0E-20173214IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MGYVLRVRLA SFFAGAATAS FAGIYLLYKD FQVAHDAISQ QDFYDGSSCN LHRPFDSGPT  60
SSYDRNKSLI NYSREHKYSV GAYGGAVGVR TLQPSDTSES TITTASAFKS PGGNMAAYLG  120
FPFTNAQWNE LERQAMIYKY MASSINVPPH LLIPTPLMGN GLDVRFTNRA DLEPGRCRRT  180
DGKKWRCSRD VAPDKKYCER HMHRGRPRSR KHVELNSSSN SNSSKKSRHD PSICTESPVT  240
VAISNPTINN NNSGSASHDH FVGTMPQPYI QTPVFVNKSS EKIATFDANG AFGSTYKEPR  300
SLDWMLKGGT GPIVTNDQQW PHLVHTEIGL ATEGSFNNAS VLKQHYREES LNLNSYGNLN  360
AREDQHSSQY SLFLDGAPRS FIDAWSNDAN SGNTSSMSSD GKLPLSPLSL SMGGNRSIDD  420
ERGQIQMGLG LIKPDQNQEC GGDTSSTPGG PLAEVLQLRT VNIDTGTNQS SSMIENGDSI  480
CPPATRVSSP SEVLQKTLAS LSDSSGNSSP TLASSRTKPE IAMLWLNQA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044718.10.0PREDICTED: growth-regulating factor 7
TrEMBLA0A3N7G3550.0A0A3N7G355_POPTR; Uncharacterized protein
STRINGPOPTR_0015s00860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.14e-37growth-regulating factor 7