PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032962.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 311aa    MW: 35214.5 Da    PI: 6.8536
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032962.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.3e-1881134356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  CCG032962.1  81 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 134
                  456899***********************************************9 PP

2HD-ZIP_I/II131.33.7e-4280170191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr++da+k+en++L++++++L++e+
  CCG032962.1  80 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFDAIKAENDALQAQNQKLHAEV 170
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-1965138IPR009057Homeodomain-like
PROSITE profilePS5007117.32976136IPR001356Homeobox domain
SMARTSM003891.8E-1779140IPR001356Homeobox domain
CDDcd000861.10E-1581137No hitNo description
PfamPF000463.2E-1581134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-1983143IPR009057Homeodomain-like
PRINTSPR000311.3E-5107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5116132IPR000047Helix-turn-helix motif
PfamPF021835.5E-15136176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MTCNGMAFFP TNFMLQISHD QDDHQPPTSL NPILPSPQDF RGVASFIGKR SSMSFSGIDA  60
CHEEGNGEDE LSDDGSQAGE KKRRLNMEQV KTLEKNFELG NKLEPERKMQ LARALGLQPR  120
QIAIWFQNRR ARWKTKQLEK DYDLLKRQFD AIKAENDALQ AQNQKLHAEV ISCKNLTHHR  180
LAIEILALKS REPTEPINLN KETEGSSCNR SENSSDIKLD ISRTPAIDSP LSNHHPTSRS  240
LFPSSSSSIR PAGVAIRPTG VAQLFQTNPS RPDIQSQKID QLVKEENLGN MFCSIEDQSG  300
FWPWLEQHHF N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011021608.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13 isoform X1
SwissprotQ8LC031e-111ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLU5FYJ90.0U5FYJ9_POPTR; Uncharacterized protein
STRINGPOPTR_0010s10340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-112HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]