PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 487aa    MW: 54110.9 Da    PI: 8.6886
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032808.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32299352255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  CCG032808.1 299 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 352
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-15296352IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28297352IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23299352IPR006447Myb domain, plants
PfamPF002499.3E-7300351IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MPLEGFFIEP SSNPVPDLSL HISPPNISSP SSLCNKKNNN ISNKVDASFN LLGRQEAIHK  60
PNTVSSMRSD SQAYIELSLA HPTTGLDEES RRSRRNLSSS RAVELPQLNP YHQHSHNHQQ  120
QQQHLHHSNS TTHHLNHINH GVSLLEVSDG LRPIKGIPVY HNRSFPFTPL EHSSRENKDP  180
KMCFYQMPYP SSSFFSPVNP YSSCSTSSPY SIGGGGLDPM SMLNSSGPNQ ALPGPYNRLA  240
PTTRFNGLSM DAFKSHQLHH HHHHHHNQYG VGSTEGSPHG LIRSRFFPKL PTKRSMRAPR  300
MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDKPA  360
SSSDGSGEED MSPIGSYGTA NERGGLQRGV QSDGSPVQQD MDYPSSTTTT TLWSNSSSGR  420
EAWPQTNSNE MDGHRQGTFQ SQQRSGQLME ESDSTRPKSY LGSSLACKNP SLEFTLGRPD  480
WPGKEHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-16300354357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-16300354357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-16300354357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-16300354357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-16300354458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142140.0AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043900.10.0PREDICTED: transcription repressor KAN1
TrEMBLA0A2K2ARM40.0A0A2K2ARM4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-71G2-like family protein