PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 245aa    MW: 27671 Da    PI: 7.288
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032694.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-201877357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq+  Le+++ +  r+ps+e++e+++++l    +++ ++V++WFqN++a++++
  CCG032694.1 18 SRWNPTKEQISMLESFYSQgIRTPSTEMIEQITSRLkaygHIEGKNVFYWFQNHKARQRQ 77
                 7*****************99**************************************97 PP

2Wus_type_Homeobox109.91.4e-351779365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt+eQi +Le+ y++G+rtP++e i++it++L++yG+ie+kNVfyWFQN+kaR+rqkq
        CCG032694.1 17 NSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKARQRQKQ 79
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8351378IPR001356Homeobox domain
SMARTSM003893.2E-61582IPR001356Homeobox domain
SuperFamilySSF466892.52E-131686IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-91877IPR009057Homeodomain-like
PfamPF000465.7E-181877IPR001356Homeobox domain
CDDcd000862.24E-71979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDNDDMDVAG SGGAPGNSRW NPTKEQISML ESFYSQGIRT PSTEMIEQIT SRLKAYGHIE  60
GKNVFYWFQN HKARQRQKQK QESMAYINNY LHKVHQPVFA HPCANVVCCP YFPQQSEVMG  120
FCQQHPKMLL PSNFKMRPRS EARTYAFNGY EPAAPYGYHD RITMNKGERT LVTINHKSSS  180
DQATLPLFPL HPTGTLEGAT TICPLGSTPP ENSINTPSSS EITTGIEEHS SDCKPFFDFF  240
YGKDS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827020.0KF982702.1 Populus tomentosa WOX2b (WOX2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042737.10.0PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLB9HPI91e-177B9HPI9_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03460.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-51WUSCHEL related homeobox 2