PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 396aa    MW: 45231 Da    PI: 7.5165
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031247.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.41.6e-17446345
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 i  +  r  tf kR++g+lKKA+E S+LC+++++viif++++k
  CCG031247.1  4 IRKEKSRMLTFRKRKAGLLKKASEFSILCGVNACVIIFGPKQK 46
                 56677899********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.44E-16187IPR002100Transcription factor, MADS-box
CDDcd002665.07E-20163No hitNo description
SMARTSM004324.8E-11159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.39146IPR002100Transcription factor, MADS-box
PfamPF003193.9E-18446IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MELIRKEKSR MLTFRKRKAG LLKKASEFSI LCGVNACVII FGPKQKDDHQ PVSPETWPPN  60
SEEVRCIINR YKGSDQPRRC YQVSDYFADK KKQIDSELAR LHKQIIKTKY PAWDDRLNNL  120
YANQLGVLID HLNAKIDLAD KKLGSFNTNQ YVMVEPGVQV ASLSPSVSHD MESYMKSRDD  180
NFLQLIHNSN PFDAQPPMVF YPEQSSHVTN LLERKYSNSY STDLQVYCEP RPLDDQLPVG  240
FQSKQTSHGN AIFWESNNGN CYSTDLQLYL EPNPLNVQPP MHFQPKQNAH RTSSYLHGME  300
DAIIKMACDQ NTSDQFGCKL SSSSNLPCVN RTAWMWDNVW FNNADSSVSY IAPTKQPIMP  360
SIQFPMSSSP HQMQSSEASD FTSNLIEFRG KGQGYN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2977060.0KC297706.1 Populus tomentosa AGL24 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043016.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLB9GRC00.0B9GRC0_POPTR; Uncharacterized protein
STRINGPOPTR_0002s25700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-26M-type_MADS family protein