PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 269aa    MW: 30810.5 Da    PI: 5.3177
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030891.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.91.4e-3710107198
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCa+Ck++rrkC+++C+lapyfp+eqpk f+n+hklFG++++l++l++l+  ++e+am+s++y++++r r Pv+G++g+i +l+ q++q+++el ++ 
  CCG030891.1  10 ACASCKYQRRKCSSECPLAPYFPSEQPKMFQNAHKLFGVRKILRILENLDYLQKEEAMRSIIYQSNIRDRFPVHGCLGIICQLHFQIRQVEEELRAVY 107
                  7********************************************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4819110IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSSECPLAPY FPSEQPKMFQ NAHKLFGVRK ILRILENLDY  60
LQKEEAMRSI IYQSNIRDRF PVHGCLGIIC QLHFQIRQVE EELRAVYAHL EMYRQHQHHQ  120
IAALTEDVPS QLELGMALPQ PCLAQQYSYS ISSNIGYSSG YLDSNDNVGN QLWTQHPYAT  180
NNNTNYMPII QSQLVASQPL STQQEIVQDY DEMHSFFDTI DDRQSYIETK EPYESSSEES  240
LKDTTQSMEH VAENELKSAA ACFSLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2661147113LOB family transfactor Ramosa2.1
5ly0_B5e-2661147113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042621.10.0PREDICTED: LOB domain-containing protein 27
SwissprotQ9STS63e-63LBD27_ARATH; LOB domain-containing protein 27
TrEMBLU5FZC10.0U5FZC1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s07390.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-55LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]