PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030601.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 767aa    MW: 83872.1 Da    PI: 6.1963
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030601.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      CCG030601.2 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.4E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.2E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-82464IPR009057Homeodomain-like
CDDcd001671.49E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MDTCSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVAKG VPIGEALEID IPPPRPKRKP SNPYPRKTGV GPPTSQAGAR  120
DGKLLTSTSS PHCRKVSDLE KEPRPEKPNG DERPTSAKEN QDDNCSEVFT LLQEAHCSSV  180
ASVNKNCVPA LEVLKKTSSF REFVPSPKKG NHDACNESFI TVEHEANQKL DSSDANQTVL  240
DNGTVKASKS ENACSLHEIL FQQKKSDDFT GALRTDGMQT MQNYPRHVPV HVLDGSLGTC  300
METPSDLSFQ DSMFHPVGDI PACPILYSHP AGSTTTDHPT NLPRSSMHQS FPFFPPFTPI  360
HHNQDDYRSF LPISSTFSSP VVSTLLQNPA AHAAASFAAT FWPYGNVESS ADSPACALEC  420
FQSGQINSAP SMAAIAAATV AAATAWWAAH GLLPICAPLH TAFACPPASA TAIQPADTDQ  480
VPPAKPERKE TTPDNPPLQG EIQDLEHSEA VQAQNSASKP PSLSSSDSEE SGGTKLNTGP  540
KVTDHELNSK ASEVQDSGKT KSRKQVDRSS CGSNTPSSSE IETDALEKTE KGKEEPKEAD  600
VNHPAYELNC RRSRSSSSMS DSWKEVSEEG RLAFQALFTR EILPQSFSPP HDLKSKMHQK  660
EDTEEKKDPD ENDGDASLLD LNSKTWGYCS GYREGEKNAV VPRCVNDGEE GLLTIGLGHR  720
NLKAHLTGFK PYKRCSLEAK ESRVGITGGQ DEEKGPKRLR LEREASV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4294100.0AB429410.1 Populus nigra PnLHY1 mRNA for transcription factor LHY, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025352.10.0PREDICTED: protein LHY-like
RefseqXP_011025353.10.0PREDICTED: protein LHY-like
RefseqXP_011025354.10.0PREDICTED: protein LHY-like
RefseqXP_011025355.10.0PREDICTED: protein LHY-like
RefseqXP_011025356.10.0PREDICTED: protein LHY-like
TrEMBLB9GRS20.0B9GRS2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18190.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-123MYB_related family protein