PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 679aa    MW: 74634.2 Da    PI: 5.1423
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030234.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.21.6e-27208261155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ +LH++Fv av+q+ G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  CCG030234.1 208 KPRVVWSVDLHQKFVAAVNQM-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 261
                  79*******************.********************************8 PP

2Response_reg85.51.5e-28231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l vdD+p+ +++l+++l+k +y ev+++ ++  ale+l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e + + +  Ga 
   CCG030234.1  23 ILAVDDDPICLKVLENLLRKCQY-EVTTTNQAVTALEMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEFVYKGVTHGAV 117
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   CCG030234.1 118 DYLLKPVRMEELKN 131
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.9E-1661679IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.7E-4320155No hitNo description
SuperFamilySSF521722.13E-3720147IPR011006CheY-like superfamily
SMARTSM004489.0E-3621133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.36622137IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.2E-2623131IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.72E-3024137No hitNo description
PROSITE profilePS5129412.102205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-29205266IPR009057Homeodomain-like
SuperFamilySSF466891.36E-18206265IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-24208261IPR006447Myb domain, plants
PfamPF002492.3E-6210259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAVDDQRGGN SVNEKKFPVG MRILAVDDDP ICLKVLENLL RKCQYEVTTT NQAVTALEML  60
RENRNKYDLV ISDVNMPDMD GFKLLELVGL EMDLPVIMLS SHGDKEFVYK GVTHGAVDYL  120
LKPVRMEELK NIWQHVIRRK KWYPEDQNRP PNQDKGDDGA GEGEQGVTST GSADQNEKLN  180
RKRKDQDEED EEEGEDGNDN EVSGNQKKPR VVWSVDLHQK FVAAVNQMGL DKAVPKKILD  240
LMNVDGLTRE NVASHLQKFR LYLKRLSGGG NQQGNMVSAF GAKDSSYLRM SSVDGFGDFR  300
SMHGPGRLST ASLSSYPSGT FLGRLNSPRG LTLQGIASSG LLQPGLLPTN QGTNLFQGIS  360
SALEPKQLQM KSINHIGEFN HKGDTAGFTL ASCFPDVKVT IGSLSNTSAT SGPPILQVNP  420
QQNQSRGSLA TQSSLSMPSL NQESFDVGVQ GSSNFLDHRC DDNWQGAVQL STFPSLPIGE  480
PFRHDRLPSS TLRGNISSTT SHIVNSPIDF CSTGSLTAPL EDSRVDMQGQ TDFIGNIFQN  540
STNYISKNRW EENSQNYNLG RNGSFGAMNS LVSGNGSIGA LNQSMDQRKR FGASMIGQSN  600
SGTLSMFQHP DVENFALDPK MRSNEDVILE QAKSQNGFVQ NNYESMDDIM NAMIKQDQND  660
GSLMDGEFRF GSFSPGSCM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-25206267364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG5181560.0HG518156.1 Populus x canadensis RR18 gene for response regulator, cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033470.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotB8AEH11e-125ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A2K2A4F10.0A0A2K2A4F1_POPTR; Two-component response regulator
STRINGPOPTR_0006s20220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12