PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 505aa    MW: 57808.2 Da    PI: 6.2638
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030015.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.71.8e-29308392186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  rW+k+ev aLi++r+++e ++++   k+plWeevs+ m++ g++rs+k+Ckekwen+nk+++k ke+ ++r s++ +tc+yf+ql+
  CCG030015.1 308 RWPKDEVEALIKVRSRIEIKFQEPGVKGPLWEEVSSLMSSMGYQRSAKRCKEKWENINKYFRKAKESPERR-SQRFKTCSYFNQLD 392
                  8********************************************************************98.67778********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.503301365IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.7E-4306364IPR009057Homeodomain-like
PfamPF138372.4E-20307394No hitNo description
CDDcd122035.40E-24307372No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MSFKLGRNEG SGNKKASVLN NQDEAAATPT LLDGNGHVNP PHAILMPRSW HPLEDYTTIK  60
EPFWKQLEKK RWGSEEEEIS GNRTRYFRPL EIEHVVDESR ERCRNLDIKF PIFNELEAIY  120
SLAKIAEANQ TGSGSVLTGD HSPTNAGHSV PSSAANNVTG VDHGSENSIG EEASLRKSQK  180
RKRKRKLKEK LSYMAGFFEN TVKKVMDHQE MLHRKFLEVI ERMDRERTDR EETWRHQEAE  240
KHNREAISRA HEWASTSSRE AQIVSYIERI TGQSINLPIR MAPPLLQPEI SNEPIKEITS  300
TKSDSHSRWP KDEVEALIKV RSRIEIKFQE PGVKGPLWEE VSSLMSSMGY QRSAKRCKEK  360
WENINKYFRK AKESPERRSQ RFKTCSYFNQ LDQLYSRSLI NYPSNTTYMP SRGVGFDIEK  420
QGHSEVLEAF AVGKDHLATI TNPPGENIKG AEMGSSRFEF DGIADKNEEL EEGSSEQDKE  480
VYKDDKQESG EQGKDDGSDD EENEN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185KRKRKRK
2179186KRKRKRKL
3180185RKRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010883.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLB9IKD40.0B9IKD4_POPTR; Uncharacterized protein
STRINGPOPTR_0018s05520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139981421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-42Trihelix family protein