PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG029931.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 378aa    MW: 41543.6 Da    PI: 6.0599
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG029931.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.5e-18207261256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  CCG029931.1 207 RKKLRLSKEQSSFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 261
                  788899***********************************************98 PP

2HD-ZIP_I/II127.27.2e-41207297192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  CCG029931.1 207 RKKLRLSKEQSSFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 297
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-17182264IPR009057Homeodomain-like
SuperFamilySSF466894.02E-18198264IPR009057Homeodomain-like
PROSITE profilePS5007117.329203263IPR001356Homeobox domain
SMARTSM003894.3E-16205267IPR001356Homeobox domain
CDDcd000862.04E-16207264No hitNo description
PfamPF000463.8E-15207261IPR001356Homeobox domain
PROSITE patternPS000270238261IPR017970Homeobox, conserved site
CDDcd146860.00483256295No hitNo description
SMARTSM003403.8E-25263306IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11263297IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MELGLSLGDA AATSKPFGFM EKSTQLTNKV TSGFCMGLSI GTDHTLQEED EDKDDHKLSN  60
NIDHNTDNTN TRTATVQANK GTSLTVDTST DPPIQLDLLP NTPVPRNQNS ILTLASDNGT  120
NFEAGSSGNM SRGFDVNRFS AVMVHEDQAD QDGATLSSSP PNSATSSFQM DFCIYSSKGG  180
SGSNTEADQA ERASSRASDE DENGSARKKL RLSKEQSSFL EESFKEHNTL TPKQKLALAK  240
ELNLRPRQVE VWFQNRRART KLKQTEVDCE YLKRCCETLT EENRRLHKEL QELRALKTSN  300
PYYMQLPATT LTMCPSCERV ATTSTSTAAT TTTTTTATNS QNNTTDPTSN TTGLSLSSSR  360
PRFYPFSHTQ THPHQPKA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1255263RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041997.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-96HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HPS00.0B9HPS0_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-87homeobox from Arabidopsis thaliana