PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG029234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 1073aa    MW: 118858 Da    PI: 8.256
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG029234.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71.1e-40145222178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dl++ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  CCG029234.1 145 TCQVDNCKEDLTKAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 222
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.9E-34140207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.906143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-37144224IPR004333Transcription factor, SBP-box
PfamPF031101.7E-29146219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MEEVGAQVAA PIFIHQALST RYCDMTSMAK KHELSYQSPN SQLQQHQFLQ TSREKNWNSK  60
AWDWDSVGFV AKPSVAAETL RLGTVSRELK KKDKSDSKNK SNSVSEDDDG LGLNLGGSLT  120
SVEEPASRPS KRVRSGSPGN GSYPTCQVDN CKEDLTKAKD YHRRHKVCEV HSKATKALVG  180
KQMQRFCQQC SRFHPLTEFD EGKRSCRRRL AGHNRRRRKT QPEDVTSRLL LPGNRDMNNN  240
GNLDIVNLLT ALARSQGGND DKSTNCPTVP DKDQLIQILN KINSLPLPMD LAAKLSNIAS  300
LNVKNPNQPS LGHQNRLNGT ASSPSTNDLL AVLSTTLTAS APDALAILSQ RSSQSSDSDK  360
SKLPGPNQVT VPHLQKRSNF DFPAVGVERI SHCYESPAED SDYQIQESRP NLPLQLFSSS  420
PENESRQKPA SPGKYFSSDS SNPIEERSPS SSPPVVQKLF PLQSTAETMK SEKMSVSREV  480
NANVGGGRSH GSVLPLELFR GPNREPDHSS FQSFPYQGGY TSSSGSDHSP SSQNSDPQDR  540
TGRIIFKLFD KDPSHFPGTL RTKIYNWLSN SPSDMESYIR PGCVVLSVYL SMPSASWEQL  600
ERNLLQLVDS LVQDSDSDLW KSGRFLLNTG RQLASHKDGK VRLCKSWRTW SSPELILVSP  660
VAVISGQETS LQLKGRNLTG LGTKIHCTYM GGYTSKEVTD SSSPGSMYDE INVGGFKIHG  720
PSPSILGRCF IEVENGFKGN SFPVIIADAS ICKELRLLES EFDEKVLVSN IVSEEQARDF  780
GRPRSREEVM HFLNELGWLF QRKSMPSMHE VPDYSVNRFK FLLIFSVERD YCVLVKTILD  840
MLVERNTCRD ELSKEHLEML HEIQLLNRSV KRRCRKMADL LIHYYIISGD NSSRTYIFPP  900
NVGGPGGITP LHLAACASGS DGLVDALTND PHEIGLSCWN SVLDANGLSP YAYAVMTKNH  960
SHNLLVARKL AGKRNGQISV AIGNEIEQAA LEQEPMTISH FQHERKSCAK CASVAAEIHG  1020
RFLGSQGLLQ RPYIHSMLAI AAVCVCVCLF FRGAPDIGLV APFKWENLNY GTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31136219184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00664PBMTransfer from Potri.002G002400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034771.10.0PREDICTED: squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2BB790.0A0A2K2BB79_POPTR; Uncharacterized protein
STRINGPOPTR_0002s00440.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]