PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG028870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 210aa    MW: 23930 Da    PI: 9.5668
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG028870.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-13111169563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  k+ rr+++NRe+ArrsR R+k++ie L+ +v +L++ N++L +++ +l +   +  +e+
  CCG028870.1 111 KKLRRMISNRESARRSRMRRKKQIEDLQYRVNQLQNMNHQLSEKVIHLLESNHQTLQEN 169
                  899*****************************************999988888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-13107171IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-12109164No hitNo description
PROSITE profilePS5021710.955109172IPR004827Basic-leucine zipper domain
PfamPF001703.6E-12111169IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-11111162No hitNo description
CDDcd147029.24E-16112163No hitNo description
PROSITE patternPS000360114129IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEPHEIKKFH GLPQANLAHN LFTFPNPIQK QYPSATSLKM QPIVESTNHT PSQANISENP  60
ESSSSLFDKF LITNSLIHVP LHIPSPNTSS VSTDSTLAEP RDQQLGISNE KKLRRMISNR  120
ESARRSRMRR KKQIEDLQYR VNQLQNMNHQ LSEKVIHLLE SNHQTLQENS QLKEKVSSLQ  180
VVLSDLLTPL RNVDDGDCNS IHLKGETSNR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010367.11e-152PREDICTED: basic leucine zipper 10-like
TrEMBLA0A2K1XI231e-144A0A2K1XI23_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03580.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.14e-22basic leucine-zipper 70