PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG028751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 1072aa    MW: 118989 Da    PI: 8.1462
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG028751.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1283.7e-40144221178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C+++l++ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  CCG028751.1 144 TCQVDNCKENLTTAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 221
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-33139206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.547142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-36143223IPR004333Transcription factor, SBP-box
PfamPF031102.6E-29145218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1072 aa     Download sequence    Send to blast
MEKVGAQVAA PMFIHQALSS RYCDLASMAK KRDLSYQMPN FQLQQHHFLE TSLEKNWNSK  60
AWDWDSVGFV ARPSDAAETS RLGTASRETK KKDESDYKIK SNSVNEDVGL GLNLGGSLTS  120
VEEPVLRPNK RVRSGSPANG SYPTCQVDNC KENLTTAKDY HRRHKVCEVH SKATKALVGK  180
QMQRFCQQCS RFHPLTEFDE GKRSCRRRLA GHNRRRRKTQ PEDVTSRLLV PGNQDINSNG  240
NLDIVNLLTA LARSQGRTDD KSTTCTTVPD KDQLIQILSK INSLPLPVDL AAKLANMATL  300
NGKNPDQPSS AHQNRLHGTA SSSSTMDLLA VLSATLAASA PDALAILSQR SSQSSDSDKS  360
KLMGPNQVTG SDLQKRSNVE FPSVGGERVS YCYESPVEDS DCHIQESRPD FPLQLFSSSP  420
ENDSPPKLAS SRKYFSSDSS NPVEDRSPSS SPPVVQKLFP LQSTAETMKY EKMPISRDVN  480
ANVEGSRSHA CVLPLELFRG SNREPDRGSF QSFPYQGGYT SSSGSDHSPS RQNSDSQDRT  540
GRLIFKLFDK DPSHFPGTLR TQIYNWLSNS PSEMESYIRP GCVVLSIYLS MSSAAWEQLE  600
RNLLQLVDSL VQDSDSDLWK SGRFLLNTGR QLASHKDGKI RLCKSWRTWS SPELISVSPV  660
AVVGGQETSL QLKGRNLTSP GTKIHCMHMG GYTLKEIMGS TSPGSIYDEI NVGGFKIHGP  720
SPNILGRCFI EVENGFKVNS FPVIIADASI CKELRLLESE FDEKAKVGDI VSEEQAHDLW  780
RPRSREEVLH FLNELGWLFQ RKRESSILEV PDFSLSRFKF LLIFSVERDY CVLVKTILDM  840
LVERNTCRDE LSKESLEMLS EVQLLNRAVK RSCRKMVDLL IHYSIVSHDN SSRTYIFPPN  900
VRGPGGITPL HLVACASGSD GLVDALTNDP HEIGLSCWNS LLDVNGQSPY AYALMTKNHS  960
YNLLVARTLA NKINAQVSVT IGNEIEQPAV EQEHRAISQF QQGRKSCAKC AIVAAKVHKR  1020
VPGSQGLLQR PYVHSMLAIA AVCVCVCLFF RGAPDIGLVS PFKWENLDFG TI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-30135218184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041129.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_011041130.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2AMS40.0A0A2K2AMS4_POPTR; Uncharacterized protein
STRINGPOPTR_0005s28010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]