PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG027912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 401aa    MW: 44197 Da    PI: 8.1095
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG027912.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.8e-40167242176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++ l +ak yhrrhkvCe+hska++v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk 
  CCG027912.1 167 RCQVEGCHVALVNAKGYHRRHKVCEMHSKAAKVIVLGLEQRFCQQCSRFHVVSEFDDAKRSCRRRLAGHNERRRKG 242
                  6*************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33161229IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.949165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-38166247IPR004333Transcription factor, SBP-box
PfamPF031104.1E-31168241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MENDGNKGQE NDHANLAWDI WKLNTSRFDL VDSNNTAAAA GITTNTTTAS VVENCSSVHP  60
EANSAHGFLF PYRNSWLYHH NNSNSYQQLS PYGGDGSILH PDPHLMCLKL GKRHYFEDST  120
SNSNINPISD RHVVGGFSVG KRGKPYYTVD GGANDEPSSS SSVNVPRCQV EGCHVALVNA  180
KGYHRRHKVC EMHSKAAKVI VLGLEQRFCQ QCSRFHVVSE FDDAKRSCRR RLAGHNERRR  240
KGSLDSVSRN SSHDKLIAGR FPCTASPTGC ALSLLSSKAD YWVSPSDLSS RSSAALRELI  300
AEHRAAILGR QLILEKHSHN HAIEDLGESQ PSSNFFITRQ QQMVSEPHKW GRFDGTTTHV  360
TLDLMQAPSS AFGFLSARGK NKEEGGECSQ LWSALEGAHA V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31159241284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017438.10.0PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLB9GPA80.0B9GPA8_POPTR; Uncharacterized protein
STRINGPOPTR_0002s14330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.46e-38squamosa promoter-like 11