PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG027026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 407aa    MW: 46447.4 Da    PI: 7.9486
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG027026.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF542.1e-171152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i  +  r  tf kR++g+lKKA+E S+LC+++++viif+++ 
  CCG027026.1 11 IRKEKSRMLTFRKRKAGLLKKASEFSILCGVDACVIIFGPKE 52
                 56677899*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.054153IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-20166IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-19188IPR002100Transcription factor, MADS-box
CDDcd002664.61E-24292No hitNo description
PRINTSPR004046.3E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGQKRIKMEL IRKEKSRMLT FRKRKAGLLK KASEFSILCG VDACVIIFGP KEKDDHQPVA  60
PETWPPSSEE VRCIISRYKG SDQPRRCYQV SDYFADKKKQ IDSELARLHK QIIKTKYPAW  120
DDRLNSLYAD QLRVLVGHLD AKIDLTEKKL GSFNSNQYSM GAPGVQAASL SPSVSHDNME  180
SYMKSRDDNL LQLIHNSNPF DAQPAMVFYP EQSSHVTNLL ERKYSNGCPT DLQVYYEPRP  240
LDDQLLVGFQ SKQTSYRTTR NASFWESNNG NCYSTDLQLY LEPNPLNIVQ PPMHFQPKQN  300
VRRTSSYLHA MEDAIMKMAC DQNTSDQFGC KLSSSSNLPC ANRTPWMWDN VWFNNADSSV  360
SYIAPTTQPI MSSIQFPMSS FPHQMQSSEA SDFTGNLEFE GKGQGYN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2977060.0KC297706.1 Populus tomentosa AGL24 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024498.10.0PREDICTED: myocyte-specific enhancer factor 2-like
TrEMBLB9GRC00.0B9GRC0_POPTR; Uncharacterized protein
STRINGPOPTR_0002s25700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-29M-type_MADS family protein