PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG025812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 677aa    MW: 74457.7 Da    PI: 6.6243
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG025812.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.43.8e-19197240145
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+
  CCG025812.1 197 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTREN 240
                  79*******************.********************987 PP

2Response_reg77.54.7e-26211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ + ll+++l++ +y +v++++++  al +l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + +  Ga 
   CCG025812.1  21 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQAITALSMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKGITHGAC 115
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   CCG025812.1 116 DYLLKPVRIEELKN 129
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-1501666IPR017053Response regulator B-type, plant
SuperFamilySSF521724.13E-3618143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.9E-4218160No hitNo description
SMARTSM004483.5E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.24120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2321129IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.35E-2322135No hitNo description
SuperFamilySSF466896.09E-12194248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-20194249IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-16197240IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MTVEQGIGDG NIDQFPIGMR VLAVDDDPTC LLLLETLLRR CQYNVTTTSQ AITALSMLRE  60
NKNKFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACDYLLK  120
PVRIEELKNI WQHVIRRRKC DNKDRNSSDN RDKPNQGSSE AIPDQKLNKK RKDQNEDEDE  180
DRDENEHENE DPATQKKPRV VWSVELHRKF VAAVNQLGID KAVPKKILDL MNVEKLTREN  240
KYRLYLKRIS TVANQQANMV AALGSSDASY LQMNSMNGMG LHNLAGSGQF HNTPFRSLPS  300
SGMLSRLNSP AVLGIRGLPS PGVIRLGHVQ SAPHSANGLS HFQPVGHPGN NGNILQGMPM  360
SLELDQIQSN KGVNYVRELP THLDDTATFP VSSGSTDMKI IAGSSNSPFA GVSGKPLVLE  420
GHGQGLQDGQ KFGNQSSLAA GSLDPGYSSH FPDHGRCNDN WSNAVQSNGV QSSSFTLNDC  480
FKQSTLHPSS IRDSMSTMAL QSRNNHCDVS SISTLPIHLQ DSKADLQCQV ATMNSDAGQI  540
INNGQLGWDD HRQDDPYHAN GMSNTINSAV PINGNGSLIG RSLDPNNMIF QRTRSFRSAG  600
QSNFVDSSLM KHNEVESSAM ETLVRSKDGY LLGQQKQQDS YVSNNFGSLE DLVSVMVKQA  660
SPPYPCLFLW RCLCFSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-19195250364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039588.10.0PREDICTED: two-component response regulator ARR12-like
RefseqXP_011039589.10.0PREDICTED: two-component response regulator ARR12-like
RefseqXP_011039590.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotA2X1N21e-143ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A2K2A8M00.0A0A2K2A8M0_POPTR; Two-component response regulator
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12