PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG025326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 513aa    MW: 56397.6 Da    PI: 8.2582
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG025326.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.8e-41166241277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv +C++dls+ k+yh+rhkvCevh+k+p v+v+g eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  CCG025326.1 166 CQVYDCNKDLSSSKDYHKRHKVCEVHTKTPRVIVNGNEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 241
                  **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.855163240IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.109.5E-32164227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-39165245IPR004333Transcription factor, SBP-box
PfamPF031104.6E-31166239IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MDFWSYASEG KGLLFSDEID LSADAFTRSR KASIGCDTEA LESAESLDLG FSEIPRKPFH  60
GSKTGAGMFV GSCVGIDSSK LVVGSANCMI ASNSSMESRS NHSNSLMESN SQDSSLFDLK  120
LGRLADCKDA QNSRFSKERL LLSSASPTAQ AKRAPVASLR PRISFCQVYD CNKDLSSSKD  180
YHKRHKVCEV HTKTPRVIVN GNEQRFCQQC SRFHLLVEFD DGKRSCRKRL AGHNERRRKP  240
QFGTLSVKPH KLLHPYQSTK FLGTSLPKRT SFLFPNMLPG GTFCPQSYEE DNWRKHVKLQ  300
ENSIYSSPSA IPIRSGQLVP KSFLHLHGNR IQKTCGISPL DIEDLTISNT ATAIHELAGL  360
SHSSCALSLL SAAESQDLSH SAGNIMVRPL ASQAGGACQT LGIANKSLGI GFSEKYVPIG  420
INSFGMNFIE VDNMGPFGVS GSGHAADLKV ETDGFLHQSD FLNAKHCVSP ENESTVDWLQ  480
LSSHLQRVEQ QRNSMKVKHE NEDFCSFGAT YRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28163239884squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091030.0AC209103.1 Populus trichocarpa clone POP056-L16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011660.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011011667.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011011676.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2K1YUI30.0A0A2K1YUI3_POPTR; Uncharacterized protein
STRINGPOPTR_0010s16400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-46SBP family protein