PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG024408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 178aa    MW: 19975.9 Da    PI: 9.8465
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG024408.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.3e-24113156245
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                   epgrCrRtDGKkWRCs++vl+++k+C++H+hrgr+rsrk +e+
  CCG024408.1 113 HEPGRCRRTDGKKWRCSKEVLPDQKYCDKHIHRGRQRSRKLVEA 156
                  69**************************************9985 PP

2QLQ40.96.4e-154074337
          QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 FT  Ql++L+ Q l+yKy+ a+ PvP +L+++i+k
  CCG024408.1 40 FTILQLHELELQSLIYKYIQAGFPVPYHLVLPIWK 74
                 7888******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-43874IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.2343974IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-114073IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.097112156IPR014977WRC domain
PfamPF088797.0E-21114155IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MEGNRRDGRS RSPSIGLGVE LGRGGSCQRL ITGCEKPYGF TILQLHELEL QSLIYKYIQA  60
GFPVPYHLVL PIWKSVTTAL GGLSSSLYQL YPSFMGCKCN NPLYMEYKNG TEHEPGRCRR  120
TDGKKWRCSK EVLPDQKYCD KHIHRGRQRS RKLVEAASHS NTSTNLSISL PGIGSTRA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029122.11e-131PREDICTED: growth-regulating factor 10-like
SwissprotQ6AWX76e-41GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS41e-118B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-31growth-regulating factor 2