PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 274aa    MW: 32703.9 Da    PI: 8.0307
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023942.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.35.7e-2533115186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e++ ++ ++k++k lWe +sk+m+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  CCG023942.1  33 QWSIQETKEFLMIRAELDPTFMEKKRNKVLWEVISKNMKEKGYNRSAEQCKCKWKNLVTRYKGCETIEPES---MRHQFPFYNELQ 115
                  7********************************************************************84...34479*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00533092IPR001005SANT/Myb domain
CDDcd122034.93E-233297No hitNo description
PfamPF138371.1E-2033117No hitNo description
PROSITE profilePS500907.483490IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEGLHHHLHH HQQQIQQQHH ISVNVDTSDR FPQWSIQETK EFLMIRAELD PTFMEKKRNK  60
VLWEVISKNM KEKGYNRSAE QCKCKWKNLV TRYKGCETIE PESMRHQFPF YNELQAIFTS  120
RMQRMLWADA EGAASGSKKK AVQLSSDEEE DNEEISEGEK GSSRKRIKKG KAVGGASCSS  180
GNSNSLRETL EDFMKQQMHM EMQWRETIEA RENERRMKEM EWRQIMEGIE NERTTMDRRW  240
REIEEQRRAR EEARAEKRDA LITALLNKLR REDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019100.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW04e-73TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9HCX71e-163B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-163(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-54Trihelix family protein