PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 494aa    MW: 54042.8 Da    PI: 6.6283
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023800.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix51.52.7e-16108189186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W++  + +L++a+ e+ ++l+rg+l++ +Weev++ ++++   +s +qCk+k +nl+kryk ++++   + s s+s++p+f+++e
  CCG023800.1 108 EWSDVAIGCLLDAYMEKFTQLSRGNLRGRDWEEVAAMVKQG---KSVEQCKNKVDNLKKRYKLERHRITTG-SISTSHWPWFQKME 189
                  5***********************************99997...699**********************99.677779*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.7E-17106191No hitNo description
Gene3DG3DSA:3.40.1160.103.9E-71241487IPR001048Aspartate/glutamate/uridylate kinase
HamapMF_01220_B32.377253488IPR015963Uridylate kinase, bacteria
SuperFamilySSF536331.7E-55254487IPR001048Aspartate/glutamate/uridylate kinase
CDDcd042543.16E-119256488No hitNo description
PfamPF006966.5E-24257467IPR001048Aspartate/glutamate/uridylate kinase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006221Biological Processpyrimidine nucleotide biosynthetic process
GO:0005737Cellular Componentcytoplasm
GO:0033862Molecular FunctionUMP kinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MASSCDEDFS LLGDDNHHHH IIHHPYRYPT KSTPIHAPPE SVLPLDGEED RQDNNETDSA  60
FADVNPYSDN EASKRSEREG EIDGGENPYN IYKRGRSGGG EYRKDREEWS DVAIGCLLDA  120
YMEKFTQLSR GNLRGRDWEE VAAMVKQGKS VEQCKNKVDN LKKRYKLERH RITTGSISTS  180
HWPWFQKMED IVGNSLPIKV APPVPAPADE DNGGGGGGGS SASVSRQSKR YANTIASPAG  240
QTNNMMPKSM SKTRWRRVIL KISGVALAGT GPNNIDPKVM TLIAREVAMA CQLGLEIAIV  300
VGARNFFCGN TWVTATGSHR RTAYQIGMMA SVMNSLLLQS ALEKIGVQTR VQTAFAMQEV  360
SEPYSRQRAI RHLEKGRVVI FGGIGAGTGN PLFSTDTAAA VQASEIHAEA VLKGTNVDGV  420
YDCHSPDSNF IFEHISIRDL VSRGATSMDM MALTFCEENN IPVVIFNLLE PGNISKALCG  480
EQVGTLIDQT GRIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ek6_F7e-602494873239Uridylate kinase
3ek6_E7e-602494873239Uridylate kinase
3ek6_D7e-602494873239Uridylate kinase
3ek6_C7e-602494873239Uridylate kinase
3ek6_B7e-602494873239Uridylate kinase
3ek6_A7e-602494873239Uridylate kinase
3ek5_F7e-602494873239Uridylate kinase
3ek5_E7e-602494873239Uridylate kinase
3ek5_D7e-602494873239Uridylate kinase
3ek5_C7e-602494873239Uridylate kinase
3ek5_B7e-602494873239Uridylate kinase
3ek5_A7e-602494873239Uridylate kinase
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00340DAPTransfer from AT3G10030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018866.10.0PREDICTED: uncharacterized protein LOC105121779 isoform X1
TrEMBLU5GCJ80.0U5GCJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40623252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10030.10.0Trihelix family protein