PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 292aa    MW: 32517.7 Da    PI: 7.3169
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023659.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-18148202256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq   Lee F++++++  +++e LA++l+L  rqV vWFqNrRa+ k
  CCG023659.1 148 RKKLRLTKEQSALLEESFKQHSNLYPKQKEALARQLNLRPRQVEVWFQNRRARTK 202
                  788899***********************************************98 PP

2HD-ZIP_I/II121.44.7e-39148237191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLEesF+++++L p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk++++alk+en rL+ke +eL+ +l
  CCG023659.1 148 RKKLRLTKEQSALLEESFKQHSNLYPKQKEALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCEALKDENGRLQKELQELK-AL 237
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-17137198IPR009057Homeodomain-like
SuperFamilySSF466892.42E-18137205IPR009057Homeodomain-like
PROSITE profilePS5007117.232144204IPR001356Homeobox domain
SMARTSM003891.5E-14146208IPR001356Homeobox domain
PfamPF000469.3E-16148202IPR001356Homeobox domain
CDDcd000861.29E-16148205No hitNo description
PROSITE patternPS000270179202IPR017970Homeobox, conserved site
SMARTSM003402.9E-23204247IPR003106Leucine zipper, homeobox-associated
PfamPF021833.9E-10204238IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGCLDDGCTT GLVLGLGFAP LTDLERSTSK PGDYSNRLIR PQIKPSLKFD HNPSTSTSFE  60
LSLSLVLSSE TYSHAGSRQK TMDGEKGCEE SIGAHDLLYR QASPDQSAVS SFSSGRVKRE  120
SDLGCEDIEV ERISSRVSDE DEDGTNARKK LRLTKEQSAL LEESFKQHSN LYPKQKEALA  180
RQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EFLKKCCEAL KDENGRLQKE LQELKALKLA  240
QPFYMHMPAA TLTMCPSCER IGGVGDGASK SSFSMVPKPD FYNTFTNPSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196204RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008396.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466048e-96HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2K2AGX70.0A0A2K2AGX7_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19080.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.17e-82HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]