PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 559aa    MW: 61290.1 Da    PI: 7.9944
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023325.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.5e-41176251277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv +C++dls+ keyh+rhkvCevhs++++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  CCG023325.1 176 CQVYDCNKDLSSSKEYHKRHKVCEVHSRTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 251
                  **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.4E-32170237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.958173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-38174253IPR004333Transcription factor, SBP-box
PfamPF031105.0E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MESGSYVLGG KGHVSNEPTS SSDTFSRSNN VLMSCDLKNQ CNFEYNFLAS GSPTIENGAR  60
GELGYQQLIE KHVPDTSIRN ALISEVSGRK NINPFVVVPN SFSLEDESTS GLSSTAMDSD  120
CRVSAFIDLN LGRFGDPRDV QNCRRIPKST SIVSPTKSSA PPRRHRAGMN SHTAFCQVYD  180
CNKDLSSSKE YHKRHKVCEV HSRTAKVIVN GIEQRFCQQC SRFHLLAEFD DGKRSCRKRL  240
AGHNERRRKP QVGLQSGRTG RLLHPYNGFS SSRFQGTALP TSFICQDILQ SGLSHPDKYG  300
ENDWWKRVKI EDGTGFSPPS AIPITNAYLH SKPLFPSNNS EKMFPTFHED GASTASRSIF  360
NGSTDRYLDV MGGRTSSSHS FLQDTSLGND EFAAFDAAST IQEFSGITAS GCARSLLSSQ  420
SQNSSSHSSG VPIAHQLLVS CRNTCYSMDQ IIGVSSQVSS SVVPNKFSSW VTSSVKGSHL  480
GPIPIPENSH GVNFDITDGV YHGFNAKDHL GSEDDTTIDL LQLSSQLQRV EHQKQSMQEK  540
QEMILSAAPA SLNKASKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291752491084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006290.10.0PREDICTED: uncharacterized protein LOC105112316
RefseqXP_011006291.10.0PREDICTED: uncharacterized protein LOC105112316
TrEMBLA0A385JIN00.0A0A385JIN0_POPTO; Squamosa promoter-binding protein-like
TrEMBLU5FPU60.0U5FPU6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-44SBP family protein