PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 163aa    MW: 18151.9 Da    PI: 7.2697
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023160.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.92e-4461051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l+++p ++r da+ s+vyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  CCG023160.1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKIFGASNVSKMLQEIPIHQRADAVGSIVYEANARMRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  CCG023160.1 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.715106IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MAGSSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK IFGASNVSKM LQEIPIHQRA  60
DAVGSIVYEA NARMRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPNLPIP  120
LDQDDKSLLL ASCNNFNSIP QYFNFASSSN VIQDPLKRES LWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024897.11e-119PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW37e-84LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH621e-116B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-85LBD family protein