PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 384aa    MW: 42330.6 Da    PI: 7.2976
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023040.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.5e-18202256256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  CCG023040.1 202 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 256
                  778899***********************************************98 PP

2HD-ZIP_I/II127.17.8e-41202292192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlsk+q+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  CCG023040.1 202 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 292
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.151198258IPR001356Homeobox domain
SuperFamilySSF466896.84E-18200267IPR009057Homeodomain-like
SMARTSM003893.7E-16200262IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-17202256IPR009057Homeodomain-like
PfamPF000463.7E-15202256IPR001356Homeobox domain
CDDcd000861.06E-15202259No hitNo description
PROSITE patternPS000270233256IPR017970Homeobox, conserved site
PfamPF021836.0E-11258292IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26258301IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MELGLSLGDA ATASKPFGFM EKSTKLTNKA SLGFCMGLSI GQNHTPQEDE DKEKHGNNDH  60
KSDNTNTAAT AEANKRKSLT VDTTDSPIQL DLLPNTPVPR NRNNSPTYVV YDNGTNCEFG  120
STGNMSRGFD VNRFPAVVVH EDQADQDVAA LSSSPPNSAT SSFQMDFCMY SSKGRSESHN  180
EADQAERASS RASDEDENGS ARKKLRLSKD QSAFLEESFK EHNTLTPKQK LALAKELNLR  240
PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR LHKELQELRA LKTSNPFYMQ  300
LPATTLTMCP SCERVATTST STSTAAATAT ATPTATTATT TTTTNNQNNT ADPTSKTTGL  360
SLGSTRPRFY PFSHTQTHPH QHTA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250258RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002298.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-100HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K2C2640.0A0A2K2C264_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-87homeobox from Arabidopsis thaliana