PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG022304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 338aa    MW: 37255.8 Da    PI: 6.0882
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG022304.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.91.6e-19254288135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp+g+ktLCnaCG++y++ +l
  CCG022304.1 254 CSHCGVQKTPQWRAGPNGSKTLCNACGVRYKSGRL 288
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.0E-859335IPR016679Transcription factor, GATA, plant
SMARTSM004011.4E-16248302IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.624248284IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.61E-14249311No hitNo description
Gene3DG3DSA:3.30.50.102.4E-15252286IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.21E-14253301No hitNo description
PROSITE patternPS003440254279IPR000679Zinc finger, GATA-type
PfamPF003202.1E-17254288IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MECVEGALKT SFRKEMAMKF SPQVLDDFWA GNVPNGMSSD DFSVEKLLDF SNENDFIEEE  60
EEEGGDKEKA CVFSVSVSPK QEALEEDKNS DRSPGFAVKD DFFSVTTSEL CVPTDDFASL  120
EWLSHFVEDS NSEYAAPFPT NVSPPEPTKE NPVEQEKLVL EEPCFKTPVP GKARSKRTRN  180
GVRVWPLGSP SLTESSSSSS STSSSSPSSP WLVYSKPGLR VEPVWIEKPV AKKMKKPAVE  240
AAAKGCGSNS SRRCSHCGVQ KTPQWRAGPN GSKTLCNACG VRYKSGRLLP EYRPACSPTF  300
SKELHSNHHR KVLEMRRKKE GSVQTEPGLA QPFVPSFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025900.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH579e-87GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HFC80.0B9HFC8_POPTR; Uncharacterized protein
STRINGPOPTR_0007s13700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.16e-60GATA transcription factor 6