PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG021924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 696aa    MW: 76743.4 Da    PI: 6.7923
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG021924.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.92.6e-19203247146
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                  kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+ Lt+e+ 
  CCG021924.1 203 KPRVVWSVELHRKFVAAVNQL-GVDKAVPKKILDLMNVEKLTRENK 247
                  79*******************.*********************985 PP

2Response_reg75.42.2e-25211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ + ll+++l++ +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + +  Ga 
   CCG021924.1  21 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQAITALRMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKGITHGAC 115
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                    +l Kp+ +eel +
   CCG021924.1 116 YYLLKPVRIEELKT 129
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1471681IPR017053Response regulator B-type, plant
SuperFamilySSF521721.85E-3518146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.3E-4118156No hitNo description
SMARTSM004481.4E-3119131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.99120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.0E-2221130IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.06E-2222135No hitNo description
SuperFamilySSF466891.27E-11200254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-19200254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-15203246IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MTIEQGIGDS NIDQFPIGMR VLAVDDDPTC LLLLETLLRR CQYNVTTTSQ AITALRMLRE  60
NKNKFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACYYLLK  120
PVRIEELKTI WQHVIRRKKS SNKDRNSSDN RDKPNQGSSE AVPDQKLHKK RKDQNGDEDE  180
DHDEDEDEHE HEHENEDPTT QKKPRVVWSV ELHRKFVAAV NQLGVDKAVP KKILDLMNVE  240
KLTRENKYRH YLKRISTVAN QQANMVAALG SSDASYLQMN SMSGLGLHGL AGSVRFHSTP  300
FRSLPSSGML DRLNSPAVLG IHGLPSPGVI QLGHVQTAPH TANGPSHFQP VGHPGNNGNI  360
LQGMPMPLVL DQIQSNKGVN YIPELPNHLD DTASFPVSSG STDTKIIAGS SNSPFVGVAN  420
KHLMLEGHGQ GLQDGQKSGK QSSLSAGSLN PGYSSHFPDH GRRNDNWSNA VQSNGAQSDS  480
FTLNDYFKQS TLHPSAIRDR MSTMALQSRN NPCDVSSVST LPIHLQDSKA DLPCRVGVAT  540
VSSHAGQLIN NGSLGWVDRR QDDPYHSNGL SNSINSAIPI NGNGNPNGFN LDPNNLFFQR  600
TTSFISTGPS NFVDTSLMKH NEVECSAMET LVRSKDGYLL GQEKLQDSSV SNNFGSLEDL  660
VSIMINQASP PCLCAFLWRC LCFFLLYFSY KICMRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-20199256164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036656.10.0PREDICTED: two-component response regulator ARR12-like isoform X2
SwissprotA2X1N21e-137ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A2K1WUJ00.0A0A2K1WUJ0_POPTR; Two-component response regulator
STRINGPOPTR_0018s02330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-110response regulator 12