PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG021441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 365aa    MW: 41737.9 Da    PI: 8.6738
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG021441.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF503.9e-16952144
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 ++i n+  r  tf kR++++lKK +  SvLC+++++viif++++
  CCG021441.1  9 ESIRNEKSRMLTFRKRKTTLLKKVSDFSVLCGVDACVIIFGPNQ 52
                 689**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.329161IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-9323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-18496IPR002100Transcription factor, MADS-box
CDDcd002662.55E-19569No hitNo description
PfamPF003194.1E-171152IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MVNGRIKIES IRNEKSRMLT FRKRKTTLLK KVSDFSVLCG VDACVIIFGP NQNDQPAATA  60
ETWPSNSDEV RCIINRYKAC DQPRKCYQGS DYFTAKKKKI DAEFAKLHRQ VLKAKYPAWD  120
DRLSSLSSDQ LRVLLGQLDT KLIETADNTL SIFKEYQYVM DNDASWMQAS SHDVEECRKR  180
NGNNNDNMDS TDFLQLVSNW KSFGARLPIP FQPEMSSPMA KLDANSLNQR TYNNGYSTLY  240
SEPKPLNVLP PVHYESKQSA YRNPSQTKTT EDAMMKIMSY QSHNNSFGCQ ASSSNNQHLS  300
CNGPLYVNPA PWTWFNKADS SVRSVASTMQ PMQPYKQFPM TSFPQQSLFS EINEFNGTAE  360
FERRD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011007446.10.0PREDICTED: agamous-like MADS-box protein AGL6
TrEMBLA0A2K2C7C90.0A0A2K2C7C9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.16e-12M-type_MADS family protein