PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG021329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 202aa    MW: 22467.8 Da    PI: 10.3076
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG021329.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.74.2e-23135178144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+ep+rCrRtDGKkWRCs+++l+ +k+C rH+hrgr+rsrk  e
  CCG021329.1 135 DPEPWRCRRTDGKKWRCSKEALPYQKYCVRHIHRGRQRSRKLEE 178
                  79**************************************9754 PP

2QLQ35.82.4e-1366100337
          QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  FT  Qlq+L  Q l+yKy+ a+ PvP +L+++i++
  CCG021329.1  66 FTVLQLQELQLQFLIYKYIQAGFPVPYHLVLPIWR 100
                  8888*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.9E-464100IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.49865100IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.2E-116699IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.074135179IPR014977WRC domain
PfamPF088791.2E-19136176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MESQAPPSKF ARLSNSRTRL ASGWNVERNR RGDGESGSPP LGLGLELGRG GSSQRPIISC  60
KKPYGFTVLQ LQELQLQFLI YKYIQAGFPV PYHLVLPIWR SVAASLGGLS SRLYELYPSL  120
MGCNPLYLAC KNGMDPEPWR CRRTDGKKWR CSKEALPYQK YCVRHIHRGR QRSRKLEESA  180
SHGNSSTDLS ISLPAGISGA SA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033852.11e-147PREDICTED: growth-regulating factor 10-like
SwissprotQ6AWX78e-40GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLU5GJ981e-118U5GJ98_POPTR; Uncharacterized protein
STRINGPOPTR_0003s11800.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-26growth-regulating factor 2