PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG021014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 558aa    MW: 62349.8 Da    PI: 6.355
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG021014.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.76.9e-781715502374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL  cA a++ g+l+++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s++  ++++ + + ++++ +   +al  f+evsP++ f + +aN
  CCG021014.1 171 EQLLNPCAAAITIGNLSRVQHLLYVLHELASPTGDANHRLAAHGLRALTHHLSSSSTLSSASIGTVTFASTEPKFFQKALLKFYEVSPWFAFPNNIAN 268
                  689***************************************************7777777789999998888888888888**************** PP

         GRAS 100 qaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlva 183
                    Il+ + +e    + +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++ + +++               +  +rL  fA+ +++++e++ l  
  CCG021014.1 269 ASILQVLGQEqdptRILHILDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVITATTENdqsteppfsIGPPGDNFPSRLLGFAKFMNINLEIKRLDG 366
                  *******9998885566************************55566*******998777787777776667788999******************988 PP

         GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerflealeyysalfdsleaklpre 278
                    l++l+ + ++ kp+Eal+V+ +++lh+l    +++++er+e+L+++++l+Pk v+++e+++d+  ns ++F+++f++ +ey + ++ds+++ +   
  CCG021014.1 367 YPLQKLSESIIDAKPEEALIVCAQFRLHHLN---HNTPDERTEFLRVLRRLEPKGVILSENNMDCscNScGDFATGFSRRVEYLWRFLDSTSSAF--- 458
                  8*****************************8...77777889********************8875444259*******************6664... PP

         GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   + r + Er++++ e +++++++g++    +e   kW er++ +GF    ++e+a + a++llrk++ ++++r e ++g++ l Wk++p+ ++S W+
  CCG021014.1 459 -KGRESEERRMMEGEGSKALTNRGEM----NEGIDKWCERMKGVGFVGEMFREDAIDGARALLRKYDsNWEMRTEGKDGCVGLWWKGQPVSFCSLWK 550
                  .4555555555555678889999988....9************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.532144529IPR005202Transcription factor GRAS
PfamPF035142.4E-75171550IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MTIEGSEPNQ ASDHILDWLE DSVSFLPSFL DDPYNAADIN PYQWWEQAEE ICQDLANTNT  60
SLSSSTTTST TTNINTTSLI SPNNPTISNH PPTSTSNKKR KDPEDPVPKT SQNHNQRRNL  120
NHRVNKEEQD GEAVVGEVVA VKKSNGNKNR TNKSTDNNSN NGNKKEGRWA EQLLNPCAAA  180
ITIGNLSRVQ HLLYVLHELA SPTGDANHRL AAHGLRALTH HLSSSSTLSS ASIGTVTFAS  240
TEPKFFQKAL LKFYEVSPWF AFPNNIANAS ILQVLGQEQD PTRILHILDI GVSHGVQWPT  300
LLEALTRRPG GPPPLVRITV ITATTENDQS TEPPFSIGPP GDNFPSRLLG FAKFMNINLE  360
IKRLDGYPLQ KLSESIIDAK PEEALIVCAQ FRLHHLNHNT PDERTEFLRV LRRLEPKGVI  420
LSENNMDCSC NSCGDFATGF SRRVEYLWRF LDSTSSAFKG RESEERRMME GEGSKALTNR  480
GEMNEGIDKW CERMKGVGFV GEMFREDAID GARALLRKYD SNWEMRTEGK DGCVGLWWKG  540
QPVSFCSLWK LDMKGRES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-4116755084473Protein SHORT-ROOT
5b3h_B1e-4116755030419Protein SHORT-ROOT
5b3h_E1e-4116755030419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175880.0AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
GenBankAJ9724870.0AJ972487.1 Populus trichocarpa HNO1 gene for Nodulation Signaling Pathway 1 protein homologue 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036431.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLQ4VYC30.0Q4VYC3_POPTR; Nodulation Signaling Pathway 1 protein homologue 2
STRINGPOPTR_0003s06380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-146GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]