PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG020409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 164aa    MW: 18031.7 Da    PI: 7.4233
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG020409.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.3e-4361051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdCv+apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+ssl+ eA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  CCG020409.1   6 PCASCKLLRRRCAKDCVFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLMNEAKARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  CCG020409.1 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1345106IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CVFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLMNEA KARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQPEPVMPTS  120
QMGPDDDKSF LLQNSLSQHL NYGSSSNAIH DSLKRESIFG DMIS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035872.11e-120PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9HSJ71e-114B9HSJ7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s19180.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-76LBD family protein