PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG020277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 462aa    MW: 53525.6 Da    PI: 4.9261
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG020277.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix30.59.6e-1044124185
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                  +Wt +e l L++    +e++  ++ +  ++W+ + +++    + r+ +qC+ kw++l ++y  ik+++k+ +s+s     ++ +l
  CCG020277.1  44 EWTTKEALILVNEIAAVEKDCLKALSTYQKWKIIVDNCVVLDVARNLNQCRTKWNSLVNEYNLIKNWDKESESRS----DFYWSL 124
                  5********************************************************************964433....466666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.4E-843125No hitNo description
PROSITE profilePS500906.60945101IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAEVQMEVIV NKKKRRKEQR ESKNNNQLRV SSSTPRTRSQ VSPEWTTKEA LILVNEIAAV  60
EKDCLKALST YQKWKIIVDN CVVLDVARNL NQCRTKWNSL VNEYNLIKNW DKESESRSDF  120
YWSLESERRK EFGLPENFND EVYRAIDDYM WCHKEHPDTD PDPDPDTDSE KPDLLHAITN  180
PGTKKQRWRS KSLKTPMEKT THKCCSEDNS QTIYAEEKPQ ERCVEENSQI YCTVEKPQRV  240
HAEEEHQESQ VLESTQIYDA EGKLQTIHAE EDPQESCAEE EPHTIHAEEE PEESPAGGHP  300
QPCCSKEKPQ TIHLEEETQK RYLEENHQTS CTNEKPQSIL AETQLQESHM EEKPQKSCRK  360
ENSQNAHGDE KPKIHRGCKK KMPSTEQMKQ MMVEKLHENA EMIQAVVNGN FPEMADLEAA  420
DSKNIEGFKT DLIRSQGDKL IACLQNIVNS ISQFPCLLQE CD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11115KKKRR
21116KKKRRK
31216KKRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1474660.0EF147466.1 Populus trichocarpa clone WS01231_H23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006656.10.0PREDICTED: uncharacterized protein LOC105112613 isoform X1
TrEMBLA9PGH60.0A9PGH6_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67322633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.12e-41sequence-specific DNA binding transcription factors