PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG019725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GeBP
Protein Properties Length: 380aa    MW: 43013.8 Da    PI: 5.4894
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG019725.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573125.13.2e-39157252298
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  lfqrlw+e+Dei+lL+G+idf+ak+g +ps+d++afy+f+kks++f+vs +ql +Ki rLKkKf+++vk  k+g++++fsk+hdqk f+lsk+iWgs
  CCG019725.1 157 LFQRLWTEDDEIALLRGIIDFTAKKGCDPSKDMNAFYDFIKKSLHFDVSMTQLKDKISRLKKKFENHVKG-KKGENKTFSKPHDQKGFDLSKSIWGS 252
                  79******************************************************************99.99**********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.6E-35158251IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MAPKRPPPVE DPPSPISEEE EEEDSSSTEE EEEQQQQSDG EQRQPSPPQP RNNTQNPPHK  60
ITETTTQQSE SDSESESESE SEPDQIVKPI TSKPMEETPP KAASAASKKP RSKPATAATP  120
EKTTALKRVN ETDREDSKRA KHKEPEPEKP EDSKKQLFQR LWTEDDEIAL LRGIIDFTAK  180
KGCDPSKDMN AFYDFIKKSL HFDVSMTQLK DKISRLKKKF ENHVKGKKGE NKTFSKPHDQ  240
KGFDLSKSIW GSDGSIKANG RKNDSGNTSN NNKTGNAKKL EASKSELGMD VGEEDRVEVD  300
MGRGSSVKRV LKFDSSVSVE RMEDYVVRMG LNFVHGTEKE KMEEEWRKLH VAELELFLKR  360
NELIREQAKL MLAAFKAEKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030341.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A3N7EK520.0A0A3N7EK52_POPTR; Uncharacterized protein
STRINGPOPTR_0001s30110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.16e-37DNA-binding storekeeper protein-related transcriptional regulator