PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG019434.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 556aa    MW: 62205.9 Da    PI: 7.2601
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG019434.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.71.2e-801675462374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL  cA a+  g+++++q+lL  l+elas +gd+++Rlaay ++AL ++l+ s++  +++  + + ++++ +   ++l  f+evsP++ f h +aN
  CCG019434.1 167 EQLLNPCAAAIPIGNMSRVQHLLYVLRELASLTGDANHRLAAYGLRALTHHLSPSSNLSSASTGTITFASTEPKFFQKSLLKFYEVSPWFAFPHNIAN 264
                  689**************************************************95555555556666665566666666666**************** PP

         GRAS 100 qaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlva 183
                    Il+ +++e    + +H++D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++ +++++               +  +rL  fA++++++++++ l  
  CCG019434.1 265 ASILQVLAQEqdprRNLHVLDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVITAASENdqttetpfsIGPPGDNFSSRLIGFAKSMNINLQIKRLDN 362
                  ********998888899************************55566*******998877777776666666778999******************999 PP

         GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerflealeyysalfdsleaklpre 278
                  ++l++l+   +++kp+Eal+V+ +++lh+l    +++++er+e+L+++++l+Pk v+++e+++d+  ns ++F+++f++ ley + ++ds+++ +   
  CCG019434.1 363 HSLQKLSGGIIDTKPDEALIVCAQFRLHHLN---HNTPDERTEFLRVLRRLEPKGVILSENNMDCscNScGDFATGFSRRLEYLWRFLDSTSSAF--- 454
                  9*****************************8...77777889********************8875444259*******************7775... PP

         GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   + r + Er++++ e+ +++++ g++    +e +ekW er++ +GF    ++e+a + a++llrk++ ++++r e ++g++ l Wk++p+ ++S W+
  CCG019434.1 455 -KGRESEERRVMEGEAAKALTNHGEM----NEGKEKWCERMRGVGFVGELFGEDAIDGARALLRKYDsNWEMRGEGKDGCVGLWWKGQPVSFCSLWK 546
                  .6777777777778899*******99....9************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.899140525IPR005202Transcription factor GRAS
PfamPF035144.3E-78167546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MTIEESEPSH TSDHVLDWLE DSVSFVPSFF DDPYNTADTN PCQWWDQAEE IYQDLVNTNT  60
SLSSSITRST TTTINTTSLV PPITPTLSNH PQSTTSNKKR KDPEDPVTKT SQNHHQRKNP  120
NKWINKKQQD GEVVVVVKKS NGYKKTTNKV TGINGNNGNN KEGRWAEQLL NPCAAAIPIG  180
NMSRVQHLLY VLRELASLTG DANHRLAAYG LRALTHHLSP SSNLSSASTG TITFASTEPK  240
FFQKSLLKFY EVSPWFAFPH NIANASILQV LAQEQDPRRN LHVLDIGVSH GVQWPTLLEA  300
LTRRPGGPPP LVRITVITAA SENDQTTETP FSIGPPGDNF SSRLIGFAKS MNINLQIKRL  360
DNHSLQKLSG GIIDTKPDEA LIVCAQFRLH HLNHNTPDER TEFLRVLRRL EPKGVILSEN  420
NMDCSCNSCG DFATGFSRRL EYLWRFLDST SSAFKGRESE ERRVMEGEAA KALTNHGEMN  480
EGKEKWCERM RGVGFVGELF GEDAIDGARA LLRKYDSNWE MRGEGKDGCV GLWWKGQPVS  540
FCSLWKLDMK GSESKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2318954626375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9724860.0AJ972486.1 Populus trichocarpa HNO1 gene for Nodulation Signaling Pathway 1 protein homologue 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035720.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLQ4VYC40.0Q4VYC4_POPTR; Nodulation Signaling Pathway 1 protein homologue 1
STRINGPOPTR_0001s16890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-176GRAS family protein