PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG019102.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89680.8 Da    PI: 6.4687
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG019102.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-21117172156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  CCG019102.1 117 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 172
                  688999***********************************************999 PP

2START1992.1e-623275521206
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ela++a++elvk+++ +ep+W  s     e++n +e+l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t++vi
  CCG019102.1 327 ELALAAMDELVKMVQTDEPLWIGSFeggrEILNHEEYLRTFTPCIGmkpsgFVSEASRETGMVIINSLALVETLMDSN-RWAEMFPcmiaRTSTTDVI 423
                  5899******************9999****************999899******************************.******************* PP

                  CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
        START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                   sg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +v +++lpSg+++++++ng+skvtwveh+++++r
  CCG019102.1 424 ASGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGaPPTYVNCRRLPSGFVVQDMPNGYSKVTWVEHAEYDER 521
                  ******************************************************999999999*********************************** PP

                  XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 176 lphwllrslvksglaegaktwvatlqrqcek 206
                  + h+l+r++++sg+ +ga++w atlqrqce+
  CCG019102.1 522 QLHQLYRPVISSGMGFGAQRWIATLQRQCEC 552
                  *****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-20100174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21104174IPR009057Homeodomain-like
PROSITE profilePS5007117.216114174IPR001356Homeobox domain
SMARTSM003891.7E-17115178IPR001356Homeobox domain
CDDcd000862.03E-18116174No hitNo description
PfamPF000462.2E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084844.353318555IPR002913START domain
SuperFamilySSF559612.2E-33320552No hitNo description
CDDcd088752.02E-122322551No hitNo description
PfamPF018522.9E-54327552IPR002913START domain
SMARTSM002341.3E-46327552IPR002913START domain
SuperFamilySSF559611.65E-22580814No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MSFGGFLENT SPGGGGARIV ADIPYNNNKN MPPGAMAQTR LVSPSLTKSV FNSPGLSLAL  60
QQPNIDGQGD ITRLAENFET SVGRRSREEE HESRSGSDNM DGASGDDQDA ADKPPRKKRY  120
HRHTPQQIQE LEALFKECPH PDEKQRLELS RRLCLETRQV KFWFQNRRTQ MKTQLERHEN  180
SLLRQDNDKL RAENMSIRDA MRNPSCSNCG GPAIIGDISL EEQHLRIENA RLKDELDRVC  240
ALAGKFLGRP ISSLASSHGP PMPNSSLELA VGSNGFAGLS TMATTLPLGP HFEGGISGAL  300
PMVTQTRLAT AGVTGIDRSL ERSMFLELAL AAMDELVKMV QTDEPLWIGS FEGGREILNH  360
EEYLRTFTPC IGMKPSGFVS EASRETGMVI INSLALVETL MDSNRWAEMF PCMIARTSTT  420
DVIASGMGGT RNGSLQLMHA ELQVLSPLVP VREVNFLRFC KQHAEGVWAV VDVSIDTIRE  480
TSGAPPTYVN CRRLPSGFVV QDMPNGYSKV TWVEHAEYDE RQLHQLYRPV ISSGMGFGAQ  540
RWIATLQRQC ECLAILLSSN VPSRDHTAIT TSGRRSMLKL AQRMTDNFCA GVCASTVHKW  600
NKLNAGNVDE DVRVMTRKRV NDPGEPPGIV LSAATSVWLP VSPQRLFDFL RNERLRSEWD  660
ILSNGGPMQE MAHIAKGQDH GNCVSLLRAS AMNANQSSML ILQETCMDAA GSLVVYAPVD  720
TPAMHVVMNG GDSAYVALLP SGFAIVPDGP GSSDHQTTNG GPNANNVGGQ ERVSGSLLTV  780
AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALQCE S
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023404.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A385JHT90.0A0A385JHT9_POPTO; Homeodomain protein
TrEMBLB9GPV90.0B9GPV9_POPTR; Uncharacterized protein
STRINGPOPTR_0002s15610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]