PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG019037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 361aa    MW: 39811.4 Da    PI: 7.6033
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG019037.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-1390134147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      CCG019037.1  90 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 134
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1684140IPR009057Homeodomain-like
PROSITE profilePS5129415.40885139IPR017930Myb domain
TIGRFAMsTIGR015571.7E-1888137IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-688140IPR009057Homeodomain-like
SMARTSM007175.3E-1189137IPR001005SANT/Myb domain
PfamPF002493.1E-1190134IPR001005SANT/Myb domain
CDDcd001672.47E-892135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MVSVNPNPDQ GFYFFDPMNN SNMGLPGLDS LPPPPTTTAA TPSITATATN TCNNTVSTVN  60
TNNNHNNTVM SFSEDSSKKI RKPYTITKSR ESWTEQEHDK FLEALQLFDR DWKKIEAFVG  120
SKTVIQIRSH AQKYFLKVQK SGTSEHVPPP RPKRKAAHPY PQKASKSAVV ASQATGLFQS  180
SSTLLEPGYL YRPDTISDLG NPITSGSSST WSYNSGPPVS MSQMTTDDAG LAGPTIPYNC  240
CYSSSNESTP RSWQTGKIID NKDQGKSERV MPDFAQVYSF IGSVFDPNAR DHLQRLKQMD  300
PINLETVVLL MRNLSINLTS PEFEDHRRLL ASYHVDSPKE NAGGSYSNCS VDNLGNPIPA  360
M
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684812e-72EF468481.1 Medicago truncatula MYB transcription factor MYB40 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023280.10.0PREDICTED: protein REVEILLE 5-like
SwissprotC0SVG51e-108RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A2K2BJT10.0A0A2K2BJT1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s16460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.26e-88MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]