PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG018765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 384aa    MW: 44101.1 Da    PI: 6.2528
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG018765.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.72.8e-2775156286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li +rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y+++++
  CCG018765.1  75 WVQDETRSLIGLRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEID 156
                  ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.45567131IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.2E-467133IPR009057Homeodomain-like
SMARTSM007170.002271133IPR001005SANT/Myb domain
CDDcd122033.76E-2973138No hitNo description
PfamPF138371.3E-2174158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MYSSDKPRPL DFYKEEETPS SRDNMIIEVV SSNGDLPPHH LPTTTNTNPH QMILGDSSGD  60
DNHEVKAPKK RAETWVQDET RSLIGLRREM DGLFNTSKSN KHLWEQISAK MREKGFDRSP  120
TMCTDKWRNL LKEFKKAKHQ DRGSGSAKMS YYKEIDEILR ERNKNPQYKS PIPSKVDSYM  180
QFADKGFEDT SISFGPVEAS PRPTLNLERR LDHDGHPLAI TAADAVAASG VPPWNWRETP  240
GNGAENQSYG GRVISVKYGD YTRRIGVDGT ADAIKEAIKS AFRLRSKRAF WLEDEDQIIR  300
SLDRDMPPGN YTLHLDEGLA IKVCLYDESD HIPVHTEEKI FYTEDDYRDF LSRRGWTCLR  360
EFDGYRNIDS MDDLRHDAIY RGVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A3e-5169154186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011015851.10.0PREDICTED: trihelix transcription factor GT-1-like
RefseqXP_011042307.10.0PREDICTED: trihelix transcription factor GT-1-like
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLB9HTC30.0B9HTC3_POPTR; DNA-binding protein GT-1
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68173248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein