PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG018421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 692aa    MW: 76002.9 Da    PI: 5.784
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG018421.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.2e-28192245155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv+av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  CCG018421.1 192 KPRVVWSVELHQKFVSAVNQL-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 245
                  79*******************.********************************8 PP

2Response_reg86.48.1e-2981161109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l+k +y ev+++ ++  ale+l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e + + +  Ga 
   CCG018421.1   8 VLAVDDDPICLKVLENLLRKCQY-EVTTTNQAVTALEMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEFVYKGITHGAV 102
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+  eel +
   CCG018421.1 103 DYLLKPVRLEELKN 116
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.2E-1611692IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.7E-435139No hitNo description
SuperFamilySSF521722.13E-375131IPR011006CheY-like superfamily
SMARTSM004486.3E-366118IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.5087122IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.6E-268116IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.50E-309122No hitNo description
PROSITE profilePS5129412.608189248IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-30189250IPR009057Homeodomain-like
SuperFamilySSF466892.33E-19190249IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-24192245IPR006447Myb domain, plants
PfamPF002492.0E-7194243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MFPVGMRVLA VDDDPICLKV LENLLRKCQY EVTTTNQAVT ALEMLRENRN KYDLVISDVN  60
MPDMDGFKLL ELVGLEMDLP VIMLSSHGDK EFVYKGITHG AVDYLLKPVR LEELKNIWQH  120
VIRRKKWYPQ DQNRSPNQDK GGDGAGEGDQ VTSTGSADQN GKVNRKRKDQ DEEEEGEGED  180
GNDNEESGNQ KKPRVVWSVE LHQKFVSAVN QLGLDKAVPK KILDLMNVDG LTRENVASHL  240
QKFRLYLKRL SCGANQQPNM VAGFGAKDSS YLRMGSLDGF GDFRSVPGPG QLSTTSLSSY  300
PPGSLLGRLN SPGGLTLQAI ASPGLLQPGH SRSLNNPLNT LGKLQPGLLQ TNRGSTNLFQ  360
GISSALEPKQ LQLKSMNHIG DFNHKGDATS FTLAGCFPDV KVTIGSLGNT ISSAANNPQM  420
LHVNPQQNQT RRSLATQSSL SMPSLNQESF DVGVRGSSNF LDHSRCDDNW QGVVQMSTFP  480
SNSLPLGEPF RHDPLPTSTR RDNISSSTSH IVNNPLDFSS SGSLTAPLED SRLDMQGQAD  540
LVGNIFHNTN YTSKNRWGEN SQNYNPCLNG SFGAMNSLVS GNGSMSPLSQ SMDQRKRFDA  600
SVLGQSNSGT LSMFQHLEAE NSALDRTGMR IPKMRSNEDF LLEQTKSPDG FVQNNYESLD  660
DIVNAMIKRD QNDGVLMDGE FGFESYSPGS CI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-26190251364ARR10-B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081420.0FN908142.1 Populus x canadensis mRNA for putative B-type response regulator 19 (rr19 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017979.10.0PREDICTED: two-component response regulator ARR12 isoform X1
TrEMBLB9IMH10.0B9IMH1_POPTR; Uncharacterized protein
STRINGPOPTR_0018s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-114response regulator 12