PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG018013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TCP
Protein Properties Length: 274aa    MW: 27972.2 Da    PI: 10.1454
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG018013.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.74.2e-3842127388
          TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                  +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ + s+ +++ns+s 
  CCG018013.1  42 AKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTVSVSVRAGGNSNSI 127
                  79******************************************************************888444344433333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.0E-3347134IPR005333Transcription factor, TCP
PROSITE profilePS5136928.20947101IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSDNSGAVNN GSLVDPQRNQ PPGGGGGGGG GGGGVTNGAL VAKKPPSKDR HSKVDGRGRR  60
IRMPIICAAR VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTTPAS FSTVSVSVRA  120
GGNSNSISSL SSTNIHPVGS LEHKPLLGPA PFILGKRMRP EEDGNGGGKD DDGVSVGPTI  180
GSLMGPTATA GPGGFWALPA RPDFWGFAAA APPEMVVQPT AVQQSSLFMH QQHAAAMGEA  240
SAARVGNYLP GHLNLLASLS SGHGSSGRRE DDHR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2394354e-42AC239435.2 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-305j13 map 1, complete sequence.
GenBankGQ4963334e-42GQ496333.1 Solanum lycopersicum TCP transcription factor 15 (TCP15) mRNA, complete cds.
GenBankHG9754404e-42HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755134e-42HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002260.10.0PREDICTED: transcription factor TCP21-like
SwissprotQ9FMX22e-89TCP7_ARATH; Transcription factor TCP7
TrEMBLB9H5Q11e-128B9H5Q1_POPTR; TCP family protein
STRINGPOPTR_0007s07480.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-64TCP family protein